Recombinant Bacillus halodurans UPF0756 membrane protein BH3161 (BH3161)

Shipped with Ice Packs
In Stock

Description

Overview of BH3161 Protein

BH3161 (UniProt ID: Q9K846) is a 157-amino acid membrane protein with a molecular function linked to membrane protein insertion and assembly . Its recombinant form includes an N-terminal His tag for purification and detection purposes .

PropertyDetail
Host OrganismBacillus halodurans (alkaliphilic, Gram-positive bacterium)
Recombinant SourceEscherichia coli (with N-terminal His tag)
Protein LengthFull-length (1–157 aa)
Molecular CharacteristicsPredicted molecular weight: ~18 kDa; Theoretical pI: 9.3
Structural ClassUPF0756 family, integral membrane protein

Physicochemical Characteristics

  • Purity: >90% (SDS-PAGE)

  • Storage: Lyophilized powder stable at -20°C/-80°C; reconstituted in Tris/PBS buffer with 6% trehalose (pH 8.0) .

  • Reconstitution: Recommended concentration: 0.1–1.0 mg/mL in sterile water, with glycerol (5–50%) for long-term storage .

Production and Purification

The recombinant BH3161 is expressed in E. coli via plasmid vectors and purified using affinity chromatography (Ni-NTA resin targeting the His tag) . Key steps include:

  1. Transformation: Plasmid vectors (e.g., pET28b) are introduced into E. coli strains optimized for membrane protein expression.

  2. Induction: Protein expression is induced with IPTG.

  3. Solubilization: Membrane fractions are isolated using detergents.

  4. Purification: His-tagged BH3161 is purified under denaturing or native conditions .

Role in Membrane Protein Insertion

BH3161 shares structural homology with YidC, a bacterial insertase that facilitates membrane protein assembly . The crystal structure of YidC from B. halodurans (PDB: 4XJC) reveals a hydrophilic groove lined with conserved arginine residues, which recruits extracellular domains of substrates into the membrane . Mutational studies confirm this groove’s necessity for BH3161’s function .

Interaction Partners

BH3161 may collaborate with:

  • SecYEG translocon: For co-translational insertion of multi-spanning membrane proteins .

  • OLE RNP complex: A ribonucleoprotein complex critical for stress response in B. halodurans (though direct evidence for BH3161’s involvement is lacking) .

Research Applications

  1. Structural Studies: Used in crystallography and cryo-EM to analyze membrane protein insertion mechanisms .

  2. Antibody Development: His-tagged BH3161 serves as an antigen for antibody production .

  3. Biotechnological Engineering: Insights into BH3161’s function aid in optimizing secretory pathways for recombinant therapeutics (e.g., flagellar secretion systems) .

Challenges and Future Directions

  • Stability: Repeated freeze-thaw cycles degrade the protein; glycerol supplementation is critical .

  • Functional Redundancy: Overlap with YidC complicates in vivo studies; gene knockout models are under exploration .

  • Industrial Potential: Engineered B. halodurans strains (e.g., BhFDL05S) improve recombinant peptide yields, suggesting scalable production methods .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. You may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
BH3161; UPF0756 membrane protein BH3161
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Target Names
BH3161
Target Protein Sequence
MISQATIFMLVLLVIALLAKNQSLLIAVLVLLVIKFIGVGDKVFPFFQQKGISLGVTIIT IAVLTPIATGEIGFKQMGEAIRSSYAWVALLSGVVVALIAASGIDLLKNDPHITTALVLG TILAVAVFNGVAVGPLIGAGIAYLTMKVVQWLGSFWG
Uniprot No.

Target Background

Database Links

KEGG: bha:BH3161

STRING: 272558.BH3161

Protein Families
UPF0756 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus halodurans UPF0756 membrane protein BH3161?

BH3161 is a membrane protein belonging to the UPF0756 protein family, originating from the alkaliphilic bacterium Bacillus halodurans strain C-125 (ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153). The protein consists of 157 amino acids and has a UniProt accession number of Q9K846 . As a membrane protein, BH3161 is integrated into the bacterial cell membrane and likely plays a role in membrane-associated functions, though its precise biological function remains under investigation. The protein belongs to an uncharacterized protein family (UPF), indicating that its function has not been fully elucidated through experimental studies.

What are the predicted structural features of BH3161?

Based on computational analyses and comparison with related membrane proteins, BH3161 likely contains multiple transmembrane domains with alpha-helical structures that span the bacterial cell membrane. Unlike the structurally characterized dCTP deaminase-dUTPase from the same organism (PDB: 4XJC), BH3161 has not been crystallized, and its three-dimensional structure remains to be determined experimentally .

Membrane topology prediction algorithms suggest that the protein contains hydrophobic regions interspersed with hydrophilic loops, consistent with its classification as a membrane protein. The hydrophobic regions likely anchor the protein within the lipid bilayer, while the hydrophilic regions may interact with the aqueous environment on either side of the membrane or with other proteins.

What expression systems are recommended for recombinant BH3161 production?

The most validated system for BH3161 expression is E. coli, which has been successfully used to produce His-tagged recombinant protein . The following table summarizes key parameters for optimal expression:

ParameterRecommended ConditionNotes
Expression HostE. coliMost commonly used for this protein
Vector TypepET series vectorsAllows for IPTG-inducible expression
Fusion TagN-terminal His-tagFacilitates purification via IMAC
Induction0.5-1 mM IPTGOptimize concentration experimentally
Temperature16-25°CLower temperatures may improve folding
Expression Duration4-16 hoursLonger at lower temperatures
MediaLB or TBTB provides higher cell density

When expressing membrane proteins like BH3161, it's crucial to optimize conditions to prevent protein aggregation and ensure proper folding. Consider using specialized E. coli strains designed for membrane protein expression, such as C41(DE3) or C43(DE3), which can accommodate higher levels of membrane protein overexpression compared to standard BL21(DE3) strains.

What purification protocol is most effective for recombinant BH3161?

Based on the available information, a multi-step purification protocol is recommended for obtaining high-purity BH3161:

  • Cell Lysis: Mechanical disruption (sonication or homogenization) in buffer containing detergents suitable for membrane protein solubilization (e.g., n-dodecyl-β-D-maltoside (DDM), CHAPS, or Triton X-100).

  • Immobilized Metal Affinity Chromatography (IMAC): Using the N-terminal His-tag, purify the protein on Ni-NTA or Co-NTA resin. A typical buffer composition would include:

    • Buffer A (binding): 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.1% detergent, 20 mM imidazole

    • Buffer B (elution): 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.1% detergent, 250-500 mM imidazole

  • Size Exclusion Chromatography: Further purify the protein and assess its oligomeric state using a Superdex 200 column with buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl, and 0.05% detergent.

  • Final Storage: Store the purified protein in Tris/PBS-based buffer with 6% trehalose at pH 8.0. For long-term storage, add glycerol to a final concentration of 50% and store at -20°C/-80°C .

The purity should be assessed via SDS-PAGE and should be greater than 90% for most research applications . Western blotting using anti-His antibodies can confirm the identity of the purified protein.

How can I determine the biological function of BH3161?

Determining the function of an uncharacterized membrane protein like BH3161 requires a multi-faceted approach:

  • Bioinformatic Analysis: Use sequence homology, protein family classification, and genomic context to generate hypotheses about protein function. Tools such as BLAST, Pfam, and STRING can identify related proteins with known functions or predict protein-protein interactions.

  • Gene Knockout/Knockdown Studies: Create a BH3161 deletion mutant in Bacillus halodurans and assess phenotypic changes under various growth conditions. Compare growth rates, morphology, and stress responses between wild-type and mutant strains.

  • Protein-Protein Interaction Studies: Employ techniques such as bacterial two-hybrid assays, co-immunoprecipitation, or pull-down assays to identify protein partners that may provide clues about function .

  • Lipidomic Analysis: Investigate changes in membrane lipid composition in wild-type versus knockout strains, which may reveal roles in lipid metabolism or membrane organization.

  • Structural Studies: Pursue structural characterization through X-ray crystallography, cryo-EM, or NMR spectroscopy, which can provide insights into function based on structural features and comparisons with characterized proteins.

  • Heterologous Expression: Express BH3161 in different bacterial hosts and assess changes in membrane properties or cellular physiology.

The UPF0756 family to which BH3161 belongs is uncharacterized, making it a challenging but potentially rewarding target for novel function discovery. Consider a systems biology approach that integrates multiple lines of evidence to develop and test functional hypotheses.

What experimental approaches are suitable for studying BH3161's membrane topology?

Understanding membrane topology is crucial for characterizing membrane proteins like BH3161. Several complementary methods can be employed:

  • Computational Prediction: Use algorithms such as TMHMM, MEMSAT, or Phobius to predict transmembrane domains and their orientation.

  • Reporter Fusion Analysis: Generate fusion constructs with reporter proteins (e.g., GFP, alkaline phosphatase, or β-lactamase) at various positions and analyze their activity/fluorescence to determine whether specific regions are intracellular or extracellular.

  • Cysteine Scanning Mutagenesis: Introduce cysteine residues at different positions and assess their accessibility to membrane-impermeable thiol-reactive reagents.

  • Protease Protection Assays: Treat membrane vesicles with proteases and identify protected fragments by mass spectrometry to determine regions embedded in the membrane.

  • Antibody Accessibility: Generate antibodies against specific domains and test their accessibility in intact cells versus permeabilized cells.

A combination of these techniques will provide a comprehensive map of BH3161's membrane topology, which is essential for understanding its structure-function relationships and for designing targeted functional studies.

How should I design experiments to investigate potential interacting partners of BH3161?

To identify proteins that interact with BH3161, consider these methodological approaches:

  • Bacterial Two-Hybrid (B2H) System: This approach allows for in vivo detection of protein-protein interactions in a bacterial host. Split a reporter protein (e.g., adenylate cyclase) and fuse each part to BH3161 and potential interacting proteins. Interaction reconstitutes the reporter activity.

  • Pull-Down Assays: Use purified His-tagged BH3161 as bait to capture interacting proteins from Bacillus halodurans cell lysates. Identify captured proteins by mass spectrometry.

  • Cross-Linking Mass Spectrometry: Utilize chemical cross-linkers to stabilize transient protein interactions in vivo before cell lysis and analysis by mass spectrometry.

  • Co-Immunoprecipitation: If antibodies against BH3161 are available, immunoprecipitate the protein from membrane fractions and identify co-precipitated proteins.

  • Proximity-Dependent Biotin Identification (BioID): Fuse BH3161 to a biotin ligase that biotinylates proteins in close proximity, allowing for subsequent purification and identification.

Experimental design should include appropriate controls:

  • Negative controls: Unrelated membrane proteins or empty vectors

  • Positive controls: Known interacting protein pairs (if available)

  • Validation experiments: Confirm interactions using multiple, independent methods

When analyzing potential interacting partners, consider the biological context and cellular localization. True interacting partners should be expressed in the same cellular compartment and ideally show functional relationships with BH3161.

How can I design experiments to investigate the effects of environmental conditions on BH3161 expression and function?

Bacillus halodurans is an alkaliphilic bacterium, suggesting that BH3161 may have evolved to function optimally under alkaline conditions. Design experiments to investigate environmental influences as follows:

  • Expression Analysis:

    • Grow B. halodurans under various pH conditions (pH 7.0-11.0), salt concentrations, and temperatures

    • Quantify BH3161 mRNA levels using qRT-PCR

    • Assess protein levels via Western blotting with antibodies against BH3161

    • Create reporter constructs (e.g., BH3161 promoter driving luciferase expression) to monitor transcriptional regulation

  • Functional Assays:

    • Develop membrane integrity assays under different environmental conditions

    • Compare wild-type and BH3161 knockout strains under stress conditions

    • Reconstitute purified BH3161 into liposomes and test membrane properties at varying pH

  • Structural Stability:

    • Use circular dichroism (CD) spectroscopy to assess secondary structure stability under different conditions

    • Employ differential scanning calorimetry (DSC) to determine thermal stability profiles

    • Conduct limited proteolysis experiments to identify flexible or exposed regions

Include appropriate experimental design elements:

  • Factorial design to test interactions between environmental variables

  • Time-course experiments to capture dynamic responses

  • Biological and technical replicates for statistical validation

  • Appropriate positive and negative controls

These experiments will provide insights into how environmental factors influence BH3161 expression and function, potentially revealing clues about its physiological role in B. halodurans adaptation to alkaline environments.

How should contradictory results in BH3161 functional studies be interpreted and resolved?

When faced with contradictory results in functional studies of BH3161, employ the following systematic approach:

  • Methodological Differences Analysis: Create a detailed comparison table of experimental methods used in each study, including:

    • Protein preparation (expression system, purification method, tags)

    • Buffer compositions and pH

    • Detergents or lipids used

    • Experimental conditions (temperature, ionic strength)

    • Detection methods and their sensitivity

  • Statistical Reassessment: Review the statistical analyses applied in each study:

    • Sample sizes and power calculations

    • Statistical tests and their appropriateness

    • Significance thresholds

    • Control for multiple comparisons

    • Consider meta-analysis approaches to integrate diverse studies

  • Replication and Validation: Design experiments that directly address the contradictions:

    • Use multiple orthogonal methods to test the same hypothesis

    • Systematically vary key parameters to identify sources of variability

    • Collaborate with other laboratories to perform identical experiments

  • Contextual Factors: Consider contextual differences that might explain contradictory results:

    • Strain-specific effects

    • Growth phase or physiological state differences

    • Uncontrolled environmental variables

    • Post-translational modifications or alternative splicing

Remember that contradictory results often reveal important biological complexities rather than experimental failures. Membrane proteins like BH3161 may exhibit context-dependent functions or multiple activities depending on environmental conditions, interaction partners, or conformational states. Approach contradictions as opportunities to uncover these nuances rather than problems to be resolved.

What statistical approaches are most appropriate for analyzing BH3161 activity data?

The analysis of BH3161 activity data requires careful statistical consideration, especially given the potential variability in membrane protein assays. Consider these approaches:

  • Experimental Design Considerations:

    • Use Latin hypercube designs to enhance generalizability when testing multiple parameters

    • Ensure adequate biological and technical replicates (minimum n=3 for each)

    • Include positive and negative controls in each experimental batch

    • Consider randomization and blinding where applicable

  • Data Preprocessing:

    • Test for normality using Shapiro-Wilk or Kolmogorov-Smirnov tests

    • Identify and handle outliers appropriately (e.g., Grubbs' test)

    • Consider data transformations if needed (log, square root)

    • Normalize to appropriate controls or standards

  • Statistical Testing:

    • For comparing two conditions: t-test (parametric) or Mann-Whitney U test (non-parametric)

    • For multiple conditions: ANOVA with appropriate post-hoc tests (Tukey, Bonferroni)

    • For dose-response relationships: regression analysis or EC50 determination

    • For time-course data: repeated measures ANOVA or mixed-effects models

  • Advanced Analyses:

    • Principal Component Analysis (PCA) for identifying patterns in multivariate data

    • Cluster analysis for identifying groups of similar conditions or treatments

    • Bayesian approaches when prior information is available

    • Machine learning for complex datasets with multiple variables

  • Reporting Standards:

    • Include effect sizes and confidence intervals, not just p-values

    • Report exact p-values rather than thresholds (e.g., p < 0.05)

    • Include power calculations, especially for negative results

    • Be transparent about statistical assumptions and their validation

By applying rigorous statistical approaches, you can enhance the reliability and reproducibility of your findings on BH3161 activity and function. Remember that statistical significance should be interpreted in the context of biological significance and practical importance .

How can I identify and analyze BH3161 homologs in other bacterial species?

Identifying and analyzing BH3161 homologs across bacterial species can provide valuable insights into its evolutionary conservation, potential function, and structural features. Follow this systematic approach:

  • Sequence-Based Homolog Identification:

    • Perform BLAST searches against bacterial genome databases using BH3161 as the query

    • Use PSI-BLAST for detecting remote homologs with lower sequence identity

    • Search specialized membrane protein databases

    • Employ profile-based methods like HMMer to detect distant relationships

  • Multiple Sequence Alignment (MSA):

    • Align identified homologs using algorithms optimized for membrane proteins (e.g., MAFFT, T-Coffee)

    • Manually review and refine alignments, particularly for transmembrane regions

    • Visualize conservation patterns using tools like WebLogo or Jalview

  • Phylogenetic Analysis:

    • Construct phylogenetic trees using maximum likelihood or Bayesian methods

    • Test multiple evolutionary models and select the best-fitting model

    • Assess node support through bootstrap analysis or posterior probabilities

    • Correlate phylogenetic patterns with bacterial taxonomy and ecological niches

  • Structural Prediction and Comparison:

    • Predict structures of homologs using tools like AlphaFold2

    • Compare predicted structures to identify conserved structural features

    • Map conservation onto structural models to identify functional sites

  • Genomic Context Analysis:

    • Examine gene neighborhoods of BH3161 homologs across species

    • Identify conserved gene clusters that might indicate functional relationships

    • Search for co-evolution patterns with other genes

This comparative approach can reveal conserved residues that are likely functionally important, species-specific adaptations, and co-evolutionary relationships with other proteins. The analysis of Bacillus species provides a particularly valuable comparative framework, as several Bacillus species have been shown to encode similar membrane proteins .

What considerations should be taken into account when involving researchers with limited BH3161 expertise in collaborative projects?

Collaborative research involving BH3161 requires careful planning to ensure effective participation from researchers with varying expertise levels. Consider these approaches:

  • Training and Knowledge Sharing:

    • Develop a comprehensive research protocol document explaining BH3161-specific techniques

    • Create a shared repository of relevant literature and protocols

    • Conduct workshops or training sessions on specialized techniques

    • Implement a mentoring system pairing experts with novices

  • Communication and Project Management:

    • Establish regular meetings with clear agendas and documentation

    • Use collaborative tools for real-time data sharing and discussion

    • Define clear roles and responsibilities based on expertise

    • Create a glossary of specialized terminology

  • Experimental Design Considerations:

    • Include researchers with diverse expertise in experimental planning

    • Design experiments with appropriate controls accessible to all participants

    • Consider the formation of research teams with complementary skills

    • Plan for co-analysis of results to incorporate multiple perspectives

  • Capacity Building:

    • Offer co-created and co-delivered research courses for those with limited experience

    • Provide opportunities for hands-on experience with guidance

    • Develop accessible introduction to specialized techniques

    • Create progressive learning paths from basic to advanced methodologies

Research involving membrane proteins like BH3161 often requires specialized knowledge and techniques. By thoughtfully structuring collaborative projects to accommodate diverse expertise levels, you can enhance both the quality of the research and the capacity building within your team. This approach aligns with current best practices in research training, which emphasize authentic engagement rather than tokenistic involvement .

What resources and databases are most valuable for BH3161 research?

For comprehensive BH3161 research, utilize these specialized resources and databases:

  • Protein Sequence and Structure Databases:

    • UniProt (Q9K846): Primary source for curated protein information

    • Protein Data Bank (PDB): For structural data of related proteins

    • RCSB: For structural information and analysis tools

    • AlphaFold DB: For predicted protein structures

  • Genomic and Taxonomic Resources:

    • NCBI Genome: For Bacillus halodurans genome information

    • Ensembl Bacteria: For comparative genomics

    • Taxonomy Browser: For evolutionary relationships

  • Specialized Membrane Protein Resources:

    • TCDB (Transporter Classification Database): For membrane protein classification

    • MemProtMD: For membrane protein simulations in lipid bilayers

    • OPM (Orientations of Proteins in Membranes): For predicted membrane orientations

  • Functional Analysis Tools:

    • KEGG: For pathway information

    • STRING: For protein-protein interaction networks

    • InterPro: For protein family and domain information

  • Experimental Protocol Repositories:

    • Protocol Exchange: For detailed methodological protocols

    • Addgene: For plasmids and expression systems

  • Commercial Resources:

    • Creative BioMart: Offers recombinant BH3161 protein for research use

    • Specialized antibodies and detection reagents

When using these resources, maintain a record of database versions, search parameters, and query dates to ensure reproducibility. For collaborative projects, consider creating a shared resource document with links to relevant databases and tools, facilitating consistent access to information across the research team.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.