Recombinant Bacillus licheniformis Holin-like protein CidA (cidA)

Shipped with Ice Packs
In Stock

Description

Functional Role and Biochemical Activity

CidA belongs to the CidA/LrgA holin family (TC# 1.E.14), which regulates programmed cell death (PCD) and membrane permeability .

Holin-Like Mechanism

  • Pore Formation: CidA oligomerizes to create membrane pores, enabling small molecule leakage (e.g., ions, metabolites) .

  • Endolysin Synergy: Lysis requires co-expression with endolysins, mirroring bacteriophage holin-endolysin systems .

  • Regulatory Role: Modulates biofilm dynamics by releasing extracellular DNA and influencing autolysis .

Comparative Analysis with Homologs

FeatureB. licheniformis CidAS. aureus CidA/LrgA
Size128 aa131 aa (CidA), 128 aa (LrgA)
Transmembrane DomainsPredicted 4 TMS4 TMS (CidA), 4 TMS (LrgA)
FunctionPCD, membrane transportBiofilm maturation, pyruvate uptake
Disulfide BondsCritical for oligomerizationEssential for activity

Production and Purification

Recombinant CidA is produced via E. coli expression systems with optimized protocols:

Workflow

  1. Cloning: cidA is cloned into expression vectors (e.g., pET) with His-tag fusion .

  2. Induction: IPTG-induced expression at 16–30°C .

  3. Purification:

    • Chromatography: Ni-NTA affinity chromatography for His-tagged proteins .

    • Reconstitution: Resuspended in Tris/PBS buffer with 6% trehalose or 50% glycerol .

Quality Control

MetricSpecificationMethod
Purity>90% (SDS-PAGE)Gel electrophoresis
Concentration0.1–1.0 mg/mL (reconstituted)Bradford assay
Storage BufferTris-based, pH 8.0HPLC-compatible

Research Applications and Significance

CidA serves as a model for studying bacterial PCD, membrane dynamics, and biofilm biology:

Experimental Uses

  • Membrane Leak Assays: Purified CidA induces liposome leakage (e.g., carboxyfluorescein release) .

  • Biofilm Studies: Deletion mutants exhibit altered biofilm architecture and DNA release .

  • Industrial Enzyme Production: B. licheniformis strains engineered with cidA homologs enhance recombinant protein secretion .

Emerging Directions

  • Therapeutic Targets: Inhibiting CidA activity to disrupt biofilm formation in pathogens.

  • Biotechnological Tools: Leveraging CidA’s pore-forming ability for controlled cell lysis in bioprocessing .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and approved beforehand. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
cidA; BLi04057; BL03941; Holin-like protein CidA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)
Target Names
cidA
Target Protein Sequence
MKTFIKGLGQVALLFLFARFMNLIVEVLHINIPGSILGIIVIFALLHFKIIKLEWIEIGA LWLLAELLLFFVPSAVGIMNYGDILAEFGTSIILVVLISTFVVMVSTGMLTQLIAKRKER KKTCSSDA
Uniprot No.

Target Background

Function

CidA, a holin-like protein from Bacillus licheniformis, enhances the activity of extracellular murein hydrolases, potentially by facilitating their export through membrane pore formation. Its function is inhibited by the antiholin-like proteins LrgAB. Under normal conditions, LrgAB likely suppresses CidA activity. However, under stress (e.g., antibiotic exposure), CidA may oligomerize in the bacterial membrane, creating lesions that compromise the proton motive force, leading to cell death. These lesions are also thought to regulate subsequent cell lysis by either granting murein hydrolases access to the cell wall or modulating their activity via changes in cell wall pH resulting from membrane depolarization.

Database Links
Protein Families
CidA/LrgA family, CidA subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does CidA function compare to other known holin systems in Bacillus species?

CidA functions as part of the LrgAB holin-like system in B. licheniformis. Unlike the initially proposed antiholin function, recent research confirms that LrgAB can act as a holin, inducing cell lysis in bacterial species. The CidA/LrgAB system shares functional similarities with holins from other Bacillus species but shows distinct regulatory mechanisms.

In B. subtilis, holins primarily work with endolysins during the late stages of sporulation to cause maternal cell death, whereas the B. licheniformis CidA appears to be regulated by a novel ArsR family transcriptional regulator called CdsR that directly represses lrgAB expression . This regulatory mechanism provides a unique control system not observed in other Bacillus holin proteins.

What genomic features characterize the cidA gene in B. licheniformis?

The cidA gene in B. licheniformis has the following genomic characteristics:

  • Gene name: cidA

  • Ordered locus names: BLi04057, BL03941

  • Expression region: 1-128 (full-length protein)

  • Located within a regulatory network influenced by the CdsR repressor

  • Often paired functionally with lrgB in the same operon

The gene encoding CidA is part of a regulatory network that balances cell survival and programmed cell death mechanisms. The expression of this gene is tightly controlled, particularly during sporulation processes .

What are the optimal conditions for expressing recombinant CidA in bacterial systems?

For optimal expression of recombinant CidA from B. licheniformis, researchers should consider:

  • Expression system selection: E. coli BL21(DE3) strains are commonly used for toxic membrane proteins like holins

  • Vector construction: The pCold expression system has proven effective for B. licheniformis proteins

  • Temperature regulation: Expression at lower temperatures (15-20°C) is recommended to reduce toxicity and improve proper folding

  • Induction parameters: IPTG concentration of 0.1-0.5 mM with induction at mid-log phase (OD600 0.4-0.6)

  • Media optimization: Use of enriched media such as 2xYT or Terrific Broth supplemented with glucose

When expressing holin-like proteins, it's crucial to monitor cell viability as overexpression can lead to premature cell lysis. Time-course analysis of expression levels should be performed to determine optimal harvest time before toxicity affects yield .

What purification strategies yield the highest purity CidA protein preparations?

Purification of CidA requires specialized approaches due to its membrane-associated nature:

  • Cell lysis: Gentle lysis methods using mild detergents (0.5-1% Triton X-100) or enzymatic approaches (lysozyme treatment)

  • Solubilization: Use of appropriate detergents (n-dodecyl β-D-maltoside or CHAPS at 1-2%)

  • Chromatography sequence:

    • Immobilized metal affinity chromatography (IMAC) with His-tagged constructs

    • Size exclusion chromatography for oligomeric state separation

    • Ion exchange chromatography for final polishing

Purification StepBuffer CompositionCritical Parameters
IMAC50 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.1% detergent, 20-250 mM imidazoleFlow rate: 0.5-1 ml/min, Imidazole gradient
Size Exclusion25 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.05% detergent, 5% glycerolColumn selection: Superdex 200
StorageTris-based buffer with 50% glycerol at -20°CAvoid freeze-thaw cycles

For optimal stability, final protein preparations should be stored in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for long-term storage .

How can researchers effectively measure the pore-forming activity of CidA in membrane systems?

To characterize the pore-forming activity of CidA, several complementary approaches can be employed:

  • Liposome leakage assays:

    • Prepare liposomes containing fluorescent dyes (calcein or carboxyfluorescein)

    • Monitor dye release after CidA addition using fluorescence spectroscopy

    • Calculate percentage of leakage relative to detergent-lysed controls

  • Electrophysiological measurements:

    • Planar lipid bilayer experiments to measure conductance changes

    • Patch-clamp techniques to characterize single-channel properties

    • Determination of ion selectivity using asymmetric salt gradients

  • Membrane permeabilization in bacterial cells:

    • SYTOX Green uptake assays to measure membrane integrity

    • Propidium iodide staining for flow cytometry analysis

    • ATP release measurements as indicators of membrane disruption

Critical controls include using known pore-forming toxins as positive controls and denatured CidA preparations as negative controls. Comparative analysis with other holin proteins, such as those identified in B. licheniformis strains that produce bacteriocins with pore-forming activity, would provide valuable functional insights .

What methods are most suitable for investigating CidA-mediated cell death mechanisms?

Investigation of CidA-mediated cell death requires multiple methodological approaches:

  • Gene expression analysis:

    • qRT-PCR to monitor expression levels of cidA, lrgAB, and regulatory genes

    • RNA-seq to identify co-regulated genes during cell death initiation

    • Reporter fusions (GFP/luciferase) to monitor real-time expression dynamics

  • Microscopy techniques:

    • Time-lapse fluorescence microscopy with membrane integrity dyes

    • Transmission electron microscopy to visualize membrane disruption

    • Super-resolution microscopy to localize CidA in membranes

  • Biochemical assays:

    • Peptidoglycan hydrolase activity measurements

    • Detection of cytoplasmic content release (proteins, nucleic acids)

    • Analysis of proton motive force dissipation using fluorescent probes

Researchers should note that CidA expression is controlled by a novel ArsR family transcriptional regulator (CdsR) that directly represses lrgAB expression. Deletion of cdsR causes cell lysis and inhibits sporulation, while lrgAB overexpression results in cell lysis without sporulation, indicating that LrgAB functions as a holin-like protein that induces cell death in Bacillus spp .

How does the CdsR transcriptional regulator control CidA expression and function?

The ArsR family transcriptional regulator CdsR plays a critical role in controlling cidA/lrgAB expression:

  • Binding mechanism:

    • CdsR directly binds to the promoter region of the lrgAB operon

    • This binding represses transcription, preventing excessive LrgAB expression

    • Deletion of cdsR results in upregulation of lrgAB and subsequent cell lysis

  • Regulatory network:

    • CdsR regulation appears to be integrated with sporulation pathways

    • The repression is likely modulated by environmental or developmental signals

    • This creates a checkpoint that prevents premature cell lysis during sporulation

  • Experimental validation approaches:

    • Electrophoretic mobility shift assays (EMSA) to confirm direct binding

    • DNase footprinting to identify precise binding regions

    • Chromatin immunoprecipitation (ChIP) to identify genome-wide binding sites

The identification of CdsR as a novel regulator of cell death via cidA/lrgAB control represents a significant advancement in understanding programmed cell death mechanisms in Bacillus species. This is the first known instance of an ArsR family transcriptional regulator governing cell death pathways .

What protein-protein interactions are essential for CidA function, and how can they be studied?

CidA function likely depends on several protein-protein interactions that can be investigated through:

  • Interaction screening methods:

    • Bacterial two-hybrid assays for initial interaction detection

    • Co-immunoprecipitation followed by mass spectrometry

    • Surface plasmon resonance for kinetic and affinity measurements

  • Key interaction partners to investigate:

    • LrgB (potential partner in holin complex formation)

    • Peptidoglycan hydrolases (functional partners in cell wall degradation)

    • Membrane proteins involved in cell division or sporulation

  • Structural approaches for interaction characterization:

    • Cryogenic electron microscopy of membrane-embedded complexes

    • Cross-linking mass spectrometry to identify interaction interfaces

    • Förster resonance energy transfer (FRET) for real-time interaction monitoring

Understanding these interactions is crucial, as the coordinated action of LrgAB with endolysins like CwlD may be central to the cell lysis mechanism. Evidence suggests that in the absence of CdsR repression, LrgAB and CwlD may collaborate to induce cell lysis through a holin-endolysin system similar to bacteriophage lysis mechanisms .

How does CidA function compare to bacteriocin-based antimicrobial mechanisms in B. licheniformis?

B. licheniformis produces various antimicrobial compounds that can be compared with CidA function:

PropertyCidA/LrgAB SystemBacteriocins (e.g., Lichenicidin)Lipopeptides (e.g., Lichenysin)
Molecular Weight~14-15 kDa (LrgAB complex)1.4-20 kDa0.8-42 kDa
MechanismMembrane pore formationMembrane pore formation, cell wall biosynthesis inhibitionMembrane disruption, biofilm destruction
SpecificitySelf-targeting/autolysisTarget specific bacteriaBroader spectrum
RegulationCdsR repressor controlGrowth phase dependentEnvironmental condition dependent
RoleProgrammed cell deathCompetition with other bacteriaEnvironmental adaptation

While bacteriocins like lichenicidin primarily target other bacteria as ecological competition mechanisms, the CidA/LrgAB system appears to function in self-directed programmed cell death pathways. Both systems share the fundamental mechanism of membrane disruption, but bacteriocins typically have specific targeting mechanisms for non-self cells, whereas CidA/LrgAB acts on the producing cell during specific developmental stages .

Could CidA-based systems be exploited for antimicrobial applications similar to B. licheniformis bacteriocins?

Exploiting CidA-based systems for antimicrobial applications presents both opportunities and challenges:

  • Potential advantages:

    • Novel mechanism distinct from conventional antibiotics

    • Possibility of targeting specific bacterial populations

    • Potential synergy with existing antimicrobial compounds

  • Research approaches:

    • Heterologous expression systems for controlled production

    • Structure-function studies to enhance activity or specificity

    • Delivery system development for targeted application

  • Comparative efficacy assessment:

    • Direct comparison with B. licheniformis bacteriocins like lichenicidin

    • Evaluation against antibiotic-resistant pathogens

    • Testing against biofilm-associated infections

The effectiveness of such applications would depend on developing systems that enable targeted delivery and activation of CidA in pathogen populations while preventing unwanted effects on beneficial bacteria. Research suggests that bacteriocins from B. licheniformis have shown activity against pathogens like Staphylococcus aureus, Listeria monocytogenes, and in some cases, Mycobacterium tuberculosis, providing a benchmark for potential CidA-based antimicrobial development .

How can CRISPR/Cas9 technology be applied to study CidA function in B. licheniformis?

CRISPR/Cas9 technology offers powerful approaches for studying CidA function:

  • Gene editing strategies:

    • Precise deletion of cidA or introduction of point mutations

    • Promoter modifications to alter expression levels

    • Insertion of fluorescent tags for localization studies

  • Implementation methodology:

    • Plasmid-based delivery systems optimized for B. licheniformis

    • Transformation protocols using electroporation

    • Selection strategies using appropriate markers

  • Experimental design considerations:

    • Off-target effect analysis using whole-genome sequencing

    • Phenotypic validation through complementation studies

    • Control experiments with non-editing Cas9 variants

Recent advances have demonstrated that CRISPR/Cas9n gene editing in B. licheniformis can achieve 100% editing efficiency for single genes, making it an ideal tool for studying cidA function. The system has been successfully used with the P43 promoter driving Cas9n expression .

What role might CidA play in biofilm formation and antimicrobial resistance in B. licheniformis?

The potential role of CidA in biofilm dynamics warrants investigation:

  • Biofilm formation hypothesis:

    • CidA-mediated cell lysis may release extracellular DNA, a critical biofilm matrix component

    • Controlled expression may facilitate structural remodeling of biofilms

    • Interactions with exopolysaccharides could influence biofilm architecture

  • Antimicrobial resistance connections:

    • Cell membrane alterations might affect antibiotic penetration

    • Subpopulation lysis could create persister cells resistant to antibiotics

    • Genetic regulation pathways might overlap with stress response systems

  • Experimental approaches:

    • Biofilm formation assays with cidA mutants versus wild-type

    • Confocal microscopy with matrix component staining

    • Combined treatment studies with antibiotics and cidA modulation

This research direction is particularly relevant given that B. licheniformis produces compounds like lichenysin that can inhibit biofilm formation by pathogenic bacteria such as Pseudomonas aeruginosa. Understanding how CidA functions within the context of the bacterium's own biofilm dynamics could provide insights into novel anti-biofilm strategies .

What are the main challenges in expressing and studying membrane-associated proteins like CidA?

Researchers face several technical challenges when working with CidA:

  • Expression toxicity issues:

    • Holin proteins can cause premature cell lysis during expression

    • Solution: Use tightly regulated expression systems with glucose repression

    • Approach: Titrate inducer concentrations and optimize induction timing

  • Protein solubilization challenges:

    • Membrane proteins require careful detergent selection

    • Solution: Screen multiple detergent types and concentrations

    • Approach: Start with milder detergents (DDM, LMNG) before stronger ones

  • Functional assay limitations:

    • Difficult to distinguish between specific and non-specific membrane disruption

    • Solution: Include appropriate controls and concentration gradients

    • Approach: Combine multiple assay types for comprehensive characterization

When expressing CidA, researchers should consider using the cold shock expression system (pCold vector) that has been successfully employed for other B. licheniformis proteins. Additionally, inclusion of stabilizing agents like glycerol (50%) in storage buffers is essential for maintaining protein activity .

How can researchers address reproducibility challenges in CidA functional studies?

Addressing reproducibility in CidA research requires systematic approaches:

  • Standardization of protein preparations:

    • Develop quantitative quality control metrics (size exclusion profiles, circular dichroism)

    • Establish minimum purity standards before functional testing

    • Create reference protein batches for inter-experiment normalization

  • Experimental design considerations:

    • Define precise environmental conditions (pH, ionic strength, temperature)

    • Establish positive and negative controls for each assay type

    • Use multiple orthogonal techniques to confirm findings

  • Reporting standards:

    • Detailed documentation of protein expression and purification protocols

    • Complete description of buffer compositions and assay conditions

    • Raw data sharing through repositories for independent analysis

To ensure consistent results, researchers should note that B. licheniformis proteins can be sensitive to growth conditions, with optimal expression often achieved using modified media compositions and precisely controlled temperature conditions. Environmental factors like oxygen availability may also significantly impact protein function and stability .

What novel approaches could advance our understanding of CidA's role in bacterial cell death mechanisms?

Emerging technologies offer new possibilities for CidA research:

  • Single-cell analysis techniques:

    • Microfluidic systems to monitor individual cell lysis events

    • Time-lapse microscopy with fluorescent reporters

    • Single-cell RNA-seq to identify transcriptional signatures preceding lysis

  • Advanced structural biology approaches:

    • Cryo-electron microscopy to visualize membrane-embedded CidA complexes

    • Solid-state NMR to characterize protein-lipid interactions

    • Molecular dynamics simulations to model pore formation mechanisms

  • Multi-omics integration:

    • Combined proteomics, metabolomics, and transcriptomics during CidA activation

    • Network analysis to identify regulatory hubs connected to CidA function

    • Comparative genomics across Bacillus species to identify evolutionary patterns

These approaches could help resolve fundamental questions about how CidA and LrgAB contribute to quality control mechanisms during sporulation, potentially eliminating improperly developed spores similar to the CmpA-mediated quality control system in B. subtilis .

How might CidA research contribute to biotechnological applications in synthetic biology?

CidA research has potential applications in synthetic biology platforms:

  • Controlled cell lysis systems:

    • Development of inducible lysis circuits for product release

    • Timed self-destruction mechanisms for biocontainment

    • Partial lysis systems for continuous product secretion

  • Protein expression optimization:

    • Design of strains with modified cell death pathways for increased protein yields

    • Controlled membrane permeabilization for improved secretion

    • Integration with B. licheniformis expression systems using engineered promoters

  • Biosensor development:

    • CidA-based detection systems for environmental triggers

    • Reporter systems linked to cell death pathways

    • Integration with multiple RBS systems for signal amplification

The B. licheniformis expression platform has already demonstrated value for producing high-value recombinant proteins. Understanding and manipulating CidA function could enhance these systems, particularly when integrated with advanced promoter engineering and ribosome binding site (RBS) optimization techniques that have shown promise in this organism .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.