Recombinant Bacillus licheniformis Multidrug resistance protein EbrB (ebrB)

Shipped with Ice Packs
In Stock

Description

Introduction to Bacillus licheniformis and Multidrug Resistance Proteins

Bacillus licheniformis is a gram-positive, spore-forming bacterium with significant industrial importance due to its excellent secretion performance and production capabilities. This organism has been successfully applied in the efficient production of various chemicals and industrial enzymes . Like many bacteria, B. licheniformis has evolved sophisticated defense mechanisms to survive in diverse environments, including specialized protein systems that confer resistance to toxic compounds.

The multidrug resistance protein EbrB represents a crucial component of this defensive arsenal. As a member of the small multidrug resistance family, EbrB contributes to the bacterium's ability to export toxic compounds from the cell, thus reducing their intracellular concentration below harmful levels. This mechanism is fundamental to the organism's survival strategy when exposed to antimicrobial agents.

Understanding the structure and function of proteins like EbrB is increasingly important as bacterial resistance to antimicrobials continues to rise globally. Recent research has highlighted the potential of probiotics and their metabolites, including those derived from B. licheniformis, as alternative approaches to combat drug-resistant pathogens like Acinetobacter baumannii .

Protein Sequence and Organization

Recombinant EbrB from Bacillus licheniformis consists of 119 amino acids. The complete amino acid sequence as obtained from the product information is:

"MKGMIFLAAA ILSEVFGSTM LKLSEGFSAP LPAAGVIIGF AASFTFLSFS LKTPLSAAYA TWAGTGTALT AAIGHFIFQE PFNLKTLIGL TLIIGGVFLL NSKRTEAADQ KAQLTIEI"

The protein is identified in the UniProt database with the accession number Q65JB2 . The gene encoding EbrB is designated by the locus names BLi01958 and BL00457 in the B. licheniformis genome . Notably, EbrB appears to be functionally linked to another multidrug resistance protein, EbrA, which is encoded adjacent to ebrB in the bacterial genome.

Membrane Integration and Structure

Based on its amino acid sequence, EbrB is characterized as a membrane-integrated protein with multiple hydrophobic regions that span the bacterial cell membrane. The presence of highly hydrophobic stretches in the sequence suggests the formation of transmembrane helices that anchor the protein within the lipid bilayer. These structural features are typical of membrane transporters involved in efflux mechanisms.

The sequence contains several notable hydrophobic regions, particularly at the N-terminal end ("MKGMIFLAAAILSEVFGSTM") and mid-sequence ("VIIGFAASFTFLSFSLKTPLSAAYA") , which likely represent transmembrane domains essential for the protein's integration into the bacterial membrane.

Expression Systems

The production of recombinant EbrB typically involves expression in suitable host systems. While the specific expression method for EbrB is not detailed in the available search results, similar recombinant proteins from B. licheniformis, such as AbrB, have been expressed using systems like pET28a(+) vectors in Escherichia coli BL21(DE3) . This approach likely applies to EbrB production as well.

The expression process generally involves:

  1. Amplification of the target gene from B. licheniformis

  2. Insertion into an appropriate expression vector

  3. Transformation into a host organism (typically E. coli)

  4. Induction of protein expression using compounds like IPTG

  5. Cell harvesting and protein extraction

Multidrug Efflux Mechanism

The primary function of EbrB is to participate in the efflux of toxic compounds from the bacterial cell, thereby contributing to multidrug resistance. This protein likely forms a functional complex with EbrA to create an active transport system that moves harmful substances against their concentration gradient, from the cytoplasm to the extracellular environment.

The transport mechanism requires energy, potentially linking EbrB function to the energy metabolism of B. licheniformis. This connection is suggested indirectly by research showing that AbrB, another regulatory protein in B. licheniformis, modulates energy metabolism by regulating genes involved in substrate-level phosphorylation, nitrate respiration, and oxidative phosphorylation .

Relationship with EbrA

EbrB functions in conjunction with EbrA, another multidrug resistance protein in B. licheniformis. The comparative characteristics of these two proteins are presented in Table 1.

Table 1: Comparison of EbrB and EbrA Multidrug Resistance Proteins in Bacillus licheniformis

CharacteristicEbrBEbrA
Protein Length119 amino acids105 amino acids
Gene LocusBLi01958, BL00457BLi01959, BL05171
UniProt AccessionQ65JB2Q65JB1
Amino Acid SequenceMKGMIFLAAA ILSEVFGSTM LKLSEGFSAP...MIAGYIFLLI AILSEAAAAA MLKISDGFAR...
Expression Region1-119 (Full length)1-105 (Full length)

The adjacent genetic positioning of ebrA and ebrB suggests they form an operon structure, with coordinated expression and functional cooperation . This arrangement is common in bacterial multidrug resistance systems, where complementary proteins work together to form an effective transport complex.

Research Applications

Recombinant EbrB serves as a valuable tool for investigating bacterial resistance mechanisms. Research into proteins like EbrB contributes to our understanding of how bacteria develop and maintain resistance to antimicrobial compounds. The availability of purified recombinant EbrB facilitates:

  1. Structure-function studies of multidrug transporters

  2. Investigation of substrate specificity and transport kinetics

  3. Development and testing of potential inhibitors

  4. Comparison with homologous proteins in other bacterial species

Biotechnological Potential

The knowledge gained from studying EbrB may have applications in biotechnology, particularly in improving the industrial performance of B. licheniformis strains. As noted in the research, B. licheniformis is valued for its "excellent secretion performance and production capabilities" in industrial settings .

Understanding and potentially modifying the expression or activity of multidrug resistance proteins like EbrB could enhance the organism's tolerance to toxic metabolites during fermentation processes, potentially improving yields of valuable products.

Antimicrobial Development Strategies

Research into bacterial multidrug resistance proteins opens avenues for developing new approaches to combat antimicrobial resistance. Recent studies have investigated metabolites from probiotic bacteria, including B. licheniformis, as potential alternatives to conventional antibiotics against drug-resistant pathogens .

One study reported that lipopeptides extracted from B. licheniformis demonstrated antibacterial activity against multidrug-resistant Acinetobacter baumannii at concentrations lower than those needed for conventional antibiotics . While this research doesn't directly involve EbrB, it highlights the broader context of research into B. licheniformis and its role in addressing antimicrobial resistance challenges.

Recent Advances

Recent research has expanded our understanding of regulatory networks in B. licheniformis, potentially providing context for the regulation of multidrug resistance systems. Studies on the role of AbrB in regulating energy metabolism in B. licheniformis have identified various target genes and transcription factors regulated by this protein . While direct connections to EbrB regulation are not established in the available search results, these findings contribute to our understanding of the broader regulatory landscape in this organism.

Research has also demonstrated the potential of B. licheniformis as a probiotic source of antimicrobial compounds. Lipopeptides extracted from B. licheniformis have shown promising activity against multidrug-resistant pathogens, suggesting alternative approaches to addressing antimicrobial resistance .

Research Challenges and Opportunities

Several challenges remain in the study of multidrug resistance proteins like EbrB:

  1. Determining high-resolution structures of membrane proteins

  2. Establishing precise substrate profiles and transport mechanisms

  3. Elucidating the regulatory networks controlling expression

  4. Developing specific inhibitors as potential therapeutic agents

These challenges present opportunities for future research that could significantly advance our understanding of bacterial resistance mechanisms and potentially lead to new strategies for combating antimicrobial resistance.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is defined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ebrB; BLi01958; BL00457; Multidrug resistance protein EbrB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)
Target Names
ebrB
Target Protein Sequence
MKGMIFLAAAILSEVFGSTMLKLSEGFSAPLPAAGVIIGFAASFTFLSFSLKTLPLSAAY ATWAGTGTALTAAIGHFIFQEPFNLKTLIGLTLIIGGVFLLNSKRTEAADQKAQLTIEI
Uniprot No.

Target Background

Function
A component of a multidrug efflux pump, conferring resistance to cationic lipophilic dyes such as ethidium bromide, acriflavine, pyronine Y, and safranin O. Efflux is likely coupled to proton influx.
Database Links
Protein Families
Small multidrug resistance (SMR) protein family, EbrA/EbrB (TC 2.A.7.1.6) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the EbrB protein in Bacillus licheniformis and how does it function in multidrug resistance?

EbrB is one component of a two-component multidrug efflux pump system (EbrAB) that confers resistance to various antimicrobial compounds. Based on studies in the closely related Bacillus subtilis, both EbrA and EbrB are necessary for drug resistance functionality, as neither component alone is sufficient to confer resistance . The system belongs to the Small Multidrug Resistance (SMR) family but represents a novel subtype requiring two separate components for function .

The EbrAB system functions by actively pumping toxic compounds out of bacterial cells using the electrochemical potential of H+ (proton motive force) as its energy source. This has been demonstrated through ethidium efflux experiments where the addition of proton conductors like CCCP significantly reduces efflux activity .

How can recombinant Bacillus licheniformis EbrB protein be expressed and purified for research purposes?

Expression of recombinant EbrB in B. licheniformis requires careful consideration of promoter selection. Several options exist:

  • Constitutive promoters derived from the bacitracin synthase operon (bacA) - These provide strong, consistent expression throughout the growth phase .

  • Inducible promoters such as those derived from the rhamnose operon (rha) - These allow controlled expression by adding specific inducers (e.g., rhamnose at concentrations of 0-20 g/L) .

For optimal expression, researchers should design expression vectors containing both ebrA and ebrB genes, as functional studies demonstrate that both components are required for activity . The expression construct should include appropriate ribosome binding sites (RBS), which can be further optimized through RBS engineering approaches .

Purification typically involves affinity chromatography using epitope tags (His-tag, FLAG-tag) added to the recombinant protein, followed by size-exclusion chromatography to obtain pure protein preparations.

What antimicrobial compounds does the EbrAB system provide resistance against?

Based on experimental evidence from studies with both B. subtilis and heterologous expression systems, the EbrAB multidrug efflux system confers resistance against several compounds:

Antimicrobial CompoundObserved ResistanceTesting Method
Ethidium bromideSignificant increase in MICBroth dilution method
AcriflavineSignificant increase in MICBroth dilution method
Pyronine YSignificant increase in MICBroth dilution method
Safranin OSignificant increase in MICBroth dilution method
TPP Cl (tetraphenylphosphonium chloride)Resistance observedBroth dilution method

These results were confirmed through both resistance assays and direct measurement of ethidium efflux activity in cells expressing the EbrAB system .

How does the expression of EbrB differ between laboratory and industrial strains of B. licheniformis?

While specific data comparing EbrB expression across different B. licheniformis strains is limited, general principles of strain variation apply. Industrial strains of B. licheniformis have been selected for their robustness in fermentation processes and high protein secretion capacity . These strains may exhibit different baseline expression levels of native efflux systems compared to laboratory strains.

Researchers should be aware that B. licheniformis has been extensively used in the fermentation industry for producing proteases, amylases, antibiotics, and specialty chemicals for over a decade . Industrial strains may have undergone adaptations that affect their intrinsic drug resistance profiles, potentially including modifications to expression levels or regulation of efflux systems like EbrAB.

What are the structural determinants of substrate specificity in the EbrB protein?

Understanding the structural basis of EbrB's substrate specificity requires analysis of:

  • Transmembrane domains: As an SMR family member, EbrB likely contains 4 transmembrane α-helices that create a hydrophobic channel for substrate transport .

  • Critical residues: Conserved charged and aromatic amino acids within transmembrane segments often create binding pockets for diverse substrates.

  • Interaction interface: The unique two-component nature of the EbrAB system suggests specific interaction sites between EbrA and EbrB that are essential for function .

Research methodology should include:

  • Site-directed mutagenesis of conserved residues

  • Chimeric protein construction with other SMR family members

  • Substrate binding assays using purified components

  • Computational modeling of protein structure and substrate docking

Key experimental evidence indicates that neither EbrA nor EbrB alone is sufficient for resistance, but when expressed together—even from separate plasmids—they confer resistance to multiple compounds . This strongly suggests a physical interaction between the two components to form a functional efflux unit.

How can the promoter systems be optimized for maximal expression of recombinant EbrB in B. licheniformis?

Optimizing promoter systems for EbrB expression requires a multifaceted approach:

Experimental approaches should include:

  • Promoter activity assays using reporter genes

  • Quantitative RT-PCR to measure transcript levels

  • Western blotting to assess protein production

  • Activity assays to confirm functional protein expression

A comprehensive testing matrix should evaluate different promoter constructs under various induction conditions to identify optimal expression parameters.

What mechanisms underlie potential synergy between the EbrAB system and other resistance mechanisms in B. licheniformis?

B. licheniformis likely employs multiple resistance mechanisms that may interact with the EbrAB system:

  • Interaction with other efflux systems: Like B. subtilis, which contains the Bmr efflux system, B. licheniformis may possess multiple efflux pumps with overlapping substrate specificities .

  • Cell envelope modifications: Changes in membrane composition can affect the efficiency of efflux systems and intrinsic permeability to antimicrobials.

  • Enzymatic inactivation mechanisms: B. licheniformis produces various enzymes that may degrade antimicrobial compounds, potentially working in concert with efflux systems.

To investigate these synergistic interactions, researchers should employ:

  • Construction of mutant strains with various combinations of resistance mechanisms

  • Transcriptomic analysis to identify co-regulated genes

  • Phenotypic assays to measure resistance profiles

  • Checkerboard assays to quantify interactions between different resistance mechanisms

Experimental evidence from B. subtilis suggests that intrinsic efflux pumps contribute to baseline resistance, as demonstrated by the relatively smaller increase in MICs observed when introducing the EbrAB system into wild-type B. subtilis compared to efflux-deficient E. coli strains .

How does the genomic context and regulation of the ebrB gene differ across various B. licheniformis strains?

Analysis of genomic context and regulation requires:

  • Comparative genomics: Examining the genomic neighborhood of ebrB across different strains to identify potential regulatory elements and operon structures.

  • Transcriptomic profiling: RNA-seq analysis under various stress conditions to identify factors that modulate ebrB expression.

  • Regulatory network mapping: ChIP-seq and similar approaches to identify transcription factors that bind to the ebrAB promoter region.

  • Strain-specific expression analysis: qRT-PCR to quantify baseline and induced expression levels in different strains.

Research methodology should include:

  • Whole genome sequencing of multiple B. licheniformis strains

  • Construction of reporter gene fusions to study promoter activity

  • Deletion analysis of potential regulatory regions

  • Heterologous expression studies in defined genetic backgrounds

While specific data on strain variation in ebrB regulation is limited, general principles of bacterial gene regulation suggest that differences in regulatory networks likely exist between environmental isolates and laboratory or industrial strains of B. licheniformis.

What are the optimal conditions for measuring EbrB-mediated efflux activity in B. licheniformis?

Designing experiments to measure EbrB-mediated efflux requires careful consideration of:

  • Substrate selection: Ethidium bromide is commonly used for efflux assays due to its fluorescence properties that change upon binding to nucleic acids .

  • Cell preparation: Energy-starved cells should be loaded with the fluorescent substrate before energizing with glucose to initiate efflux.

  • Detection methodology: Real-time fluorescence measurements should be performed to track substrate efflux kinetics.

Protocol outline:

  • Grow cells to mid-logarithmic phase

  • Harvest and wash cells in energy-depleting buffer

  • Load cells with ethidium bromide in the presence of an energy inhibitor

  • Wash and resuspend cells in fresh buffer

  • Add glucose to energize cells and initiate efflux

  • Monitor fluorescence decrease over time

  • Include controls with proton conductor (CCCP) to confirm energy dependence

Based on experimental evidence, the addition of glucose to energized cells expressing EbrAB results in rapid ethidium efflux, while the addition of CCCP inhibits this activity, confirming that the electrochemical potential of H+ is the driving force for efflux .

How can researchers develop effective assays for screening inhibitors of the EbrB component?

Developing inhibitor screening assays requires:

  • Primary screening approaches:

    • Growth inhibition assays in the presence of known EbrAB substrates

    • Direct measurement of substrate efflux inhibition

    • Competitive binding assays with labeled substrates

  • Secondary validation approaches:

    • Membrane vesicle transport assays

    • Protein-specific binding assays

    • Structure-activity relationship studies

Methodological considerations:

  • Use appropriate controls, including EbrAB-deficient strains

  • Normalize for effects on cell viability or energy metabolism

  • Consider potential off-target effects on other cellular processes

  • Validate hits with orthogonal assay methods

A key experimental approach would be to design a high-throughput fluorescence-based assay where inhibition of EbrAB-mediated efflux results in increased intracellular accumulation of fluorescent substrates like ethidium bromide.

What techniques are most effective for studying the interaction between EbrA and EbrB proteins?

Investigating the EbrA-EbrB interaction requires multiple complementary approaches:

  • Genetic approaches:

    • Complementation studies with mutant variants

    • Bacterial two-hybrid systems

    • Suppressor mutation analysis

  • Biochemical approaches:

    • Co-immunoprecipitation

    • Cross-linking studies

    • Fluorescence resonance energy transfer (FRET)

    • Surface plasmon resonance

  • Structural approaches:

    • X-ray crystallography of the complex

    • Cryo-electron microscopy

    • NMR studies of interaction interfaces

Experimental evidence from complementation studies already demonstrates that EbrA and EbrB must both be present for function, even when expressed from separate plasmids . This strongly suggests direct physical interaction between the two components.

How can heterologous expression systems be optimized for functional studies of the B. licheniformis EbrAB system?

Optimizing heterologous expression requires:

  • Host selection: Consider hosts with:

    • Low background efflux activity (e.g., E. coli KAM3 strain)

    • Compatible codon usage

    • Suitable membrane composition

    • Appropriate protein folding machinery

  • Expression construct design:

    • Codon optimization for the host organism

    • Selection of compatible promoters and ribosome binding sites

    • Consideration of appropriate fusion tags for detection/purification

    • Design of bicistronic constructs for co-expression of EbrA and EbrB

  • Validation of functional expression:

    • Antimicrobial susceptibility testing

    • Direct measurement of efflux activity

    • Protein localization studies

Experimental evidence shows that the B. subtilis EbrAB system was successfully expressed in E. coli KAM3 (an efflux-deficient strain), resulting in increased MICs for several compounds and demonstrable efflux activity . Similar approaches would be applicable for the B. licheniformis system.

How can researchers overcome difficulties in membrane protein solubilization when working with EbrB?

Membrane protein solubilization challenges require systematic optimization:

  • Detergent selection: Test multiple detergent types:

    • Mild detergents (DDM, LMNG)

    • Zwitterionic detergents (CHAPS, Fos-choline)

    • Nonionic detergents (Triton X-100)

  • Alternative solubilization methods:

    • Nanodiscs

    • Amphipols

    • Styrene maleic acid lipid particles (SMALPs)

    • Saposin-based systems

  • Stabilization strategies:

    • Addition of specific lipids

    • Inclusion of substrate during purification

    • Co-expression with EbrA to form a stable complex

Methodological approach:

  • Begin with a detergent screen at varying concentrations

  • Assess protein stability using size-exclusion chromatography

  • Validate protein function in the solubilized state

  • Consider construct optimization (removal of flexible regions, addition of stabilizing mutations)

What strategies can address the challenges of determining the stoichiometry of the EbrA-EbrB complex?

Determining complex stoichiometry requires multiple complementary techniques:

  • Analytical ultracentrifugation to determine molecular mass of the complex

  • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to measure absolute molecular weight

  • Native mass spectrometry to identify complex composition

  • Single-molecule approaches:

    • Single-molecule photobleaching

    • Single-molecule FRET

    • Fluorescence correlation spectroscopy

  • Structural methods:

    • X-ray crystallography

    • Cryo-electron microscopy

Experimental design should include careful controls for detergent/lipid contributions to measurements and validation across multiple techniques.

How can researchers differentiate between direct EbrB-mediated effects and indirect cellular responses in resistance studies?

Distinguishing direct from indirect effects requires:

  • Genetic approaches:

    • Construction of catalytically inactive mutants

    • Separation of transport function from regulatory functions

    • Controlled expression systems

  • Biochemical approaches:

    • Reconstitution in artificial membrane systems

    • Direct binding assays with purified components

    • Time-resolved studies of transport versus adaptive responses

  • Systems biology approaches:

    • Transcriptomic and proteomic analyses

    • Metabolic flux analysis

    • Network modeling of resistance mechanisms

Experimental controls should include:

  • Comparisons with structurally similar but non-functional mutants

  • Time-course analysis to separate immediate versus adaptive effects

  • Parallel studies in heterologous systems with defined backgrounds

What are the prospects for developing EbrB-targeted approaches to overcome antimicrobial resistance?

Developing EbrB-targeted approaches requires:

  • Structure-based inhibitor design:

    • High-resolution structural data on the EbrAB complex

    • Virtual screening for potential binding sites

    • Fragment-based drug discovery

    • Peptide inhibitors targeting interaction interfaces

  • Combination therapy strategies:

    • Efflux inhibitors combined with conventional antibiotics

    • Multi-target approaches addressing multiple resistance mechanisms

    • Adjuvant molecules that sensitize resistant strains

  • Alternative approaches:

    • Anti-virulence strategies

    • Phage-based approaches targeting resistant strains

    • CRISPR-Cas systems for targeted killing of resistant bacteria

Research priorities should include:

  • Identification of EbrB regions essential for function but divergent from host transporters

  • Mechanistic understanding of the transport cycle

  • Development of high-throughput screening platforms

  • In vivo validation of promising candidates

How might comparative studies across different Bacillus species inform our understanding of EbrB evolution and function?

Comparative genomics and functional studies would:

  • Trace evolutionary history of the two-component SMR systems across Bacillus species and beyond

  • Identify conserved and variable regions that may relate to substrate specificity and functional properties

  • Uncover potential horizontal gene transfer events that may have contributed to the spread of resistance mechanisms

  • Reveal ecological and physiological contexts in which these transporters provide selective advantages

Research methodology should include:

  • Phylogenetic analysis of SMR family proteins across diverse bacteria

  • Functional characterization of homologs from different species

  • Chimeric protein studies to map functional domains

  • Ecological sampling to correlate presence with environmental factors

Current evidence suggests that the two-component nature of EbrAB represents an unusual feature among SMR family transporters, raising interesting questions about its evolutionary origin and adaptive significance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.