Recombinant Bacillus licheniformis Multidrug resistance protein ykkC (ykkC)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Bacillus licheniformis Multidrug Resistance Protein ykkC

Recombinant Bacillus licheniformis multidrug resistance protein ykkC is a genetically engineered version of the native ykkC protein, produced through heterologous expression in host organisms like E. coli. This protein is a component of the small multidrug resistance (SMR) efflux pump family, which plays a critical role in bacterial survival by expelling toxic substances, including antibiotics, from the cell .

Gene Organization and Protein Interactions

The ykkC gene is paired with ykkD in an operon, forming a heterodimeric efflux pump .

  • ykkC: Encodes a transmembrane protein.

  • ykkD: Encodes an ATP-binding cassette (ABC) transporter.

Co-expression Requirement:
Resistance to drugs is only observed when ykkC and ykkD are expressed together in E. coli. Individually, neither protein confers resistance .

Efflux Activity and Substrate Specificity

The ykkC-ykkD pump exhibits broad-spectrum resistance to:

Drug ClassExamplesResistance Level
Cationic DyesEthidium bromide, acriflavineHigh
Anionic AntimicrobialsFluorouracil, novobiocinModerate
Neutral CompoundsTetraphenylphosphonium, gramicidin DVariable

Guanidine Sensing and Regulation

The ykkC riboswitch binds guanidine, a nitrogen-rich metabolite, to regulate gene expression . Structural studies reveal that guanidine interacts with the riboswitch, potentially modulating pump activity in response to environmental cues .

Genetic and Functional Studies

  • Genomic Context: B. licheniformis strains like CBA7126 harbor stress-response and antibiotic-resistance genes, including putative efflux pump components .

  • MLST Typing: Strain CBA7126 belongs to sequence type 3, linked to multidrug resistance phenotypes .

Recombinant ykkC from B. licheniformis is marketed as a research tool for studying multidrug resistance.

SupplierProductPriceQuantityPurity
e-scapebioRecombinant ykkC (50 µg)$1,450.0050 µgN/A
MyBioSourceRecombinant ykkC (B. subtilis)$1,380.00Varies>80%

Note: The B. licheniformis product is listed as unavailable for sale at e-scapebio , while B. subtilis variants remain accessible .

Antibiotic Resistance Studies

The ykkC-ykkD system serves as a model for understanding multidrug resistance mechanisms, aiding in the development of resistance-breaking antibiotics .

Industrial Biotechnology

  • B. licheniformis is leveraged for enzyme production (e.g., subtilisin), with ykkC potentially influencing stress tolerance during fermentation .

Synthetic Biology

The ykkC riboswitch offers a tool for designing guanidine-responsive gene circuits in engineered microbes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
gdnC; ykkC; BLi01409; BL03755; Probable guanidinium efflux system subunit GdnC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)
Target Names
ykkC
Target Protein Sequence
MRWGSVILAALFEIGWVMGLKHADSALEWICTAAAVVMSFYILVKAGEKLPVGTVYAVFT GLGTAGTVVCEIALFNEPANIAKLALIGVLLCGVIGLKLVTNEEKGEAS
Uniprot No.

Target Background

Function

Likely involved in guanidinium transport.

Database Links
Protein Families
Small multidrug resistance (SMR) protein family, YkkC/YkkD (TC 2.A.7.1.5) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does ykkC differ structurally and functionally from other multidrug resistance proteins in Bacillus species?

The ykkC protein in B. licheniformis shares significant homology with similar proteins in related Bacillus species but has distinct structural and functional characteristics:

SpeciesProteinSize (aa)Primary Resistance ProfileDistinguishing Features
B. licheniformisykkC109Phenicols, tetracyclines, aminoglycosidesOften co-expressed with ykkD
B. subtilisykkC107Phenicols, tetracyclines, aminoglycosidesFunctions with ykkD as part of a two-component system
B. amyloliquefaciensMultidrug efflux proteinsVariablePrimarily tetracycline resistanceOften encoded by tetL gene

Unlike other multidrug resistance mechanisms that operate through target modification (e.g., ermD for macrolide resistance) or enzymatic inactivation (e.g., cat for chloramphenicol resistance), ykkC confers resistance through active efflux . This mechanism is particularly significant as it can potentially provide resistance to multiple classes of antibiotics simultaneously.

What are the key genetic and regulatory elements associated with ykkC expression in B. licheniformis?

The expression of ykkC in B. licheniformis is regulated through several mechanisms:

  • The ykkC gene is chromosomally encoded rather than plasmid-mediated , making it an intrinsic resistance determinant in B. licheniformis.

  • Expression is often influenced by:

    • Antibiotic exposure (particularly phenicols and tetracyclines)

    • Growth phase (typically upregulated during late exponential and stationary phases)

    • Environmental stress conditions

  • Regulatory elements include:

    • A putative promoter region upstream of the coding sequence

    • Potential ribosome binding site (RBS) influencing translation efficiency

    • Possible co-regulation with adjacent genes, particularly ykkD, which often functions in tandem with ykkC

Researchers have observed that optimizing these regulatory elements can significantly impact recombinant ykkC expression levels in heterologous systems .

How can researchers optimize expression systems for recombinant B. licheniformis ykkC protein production?

Optimizing recombinant B. licheniformis ykkC expression requires careful consideration of multiple factors:

Expression System Selection and Optimization:

Expression SystemAdvantagesLimitationsOptimization Strategy
E. coliHigh yield, rapid growthPotential inclusion body formationUse solubility tags (SUMO, MBP); optimize induction conditions
B. subtilisBetter protein folding for Bacillus proteinsLower yield than E. coliOptimize promoter selection; enhance secretion capacity
Native B. licheniformisAuthentic post-translational modificationsComplex regulatory networksOverexpression using strong constitutive promoters (e.g., PbacA)

Promoter Selection:
For optimal expression in B. licheniformis, researchers should consider:

  • Strong constitutive promoters like PbacA from the bacitracin synthase operon for consistent high-level expression

  • Inducible promoters such as Pxyl (xylose-inducible) for controlled expression

  • Hybrid promoter systems combining strong -35/-10 elements with optimized spacer regions

Codon Optimization and RBS Engineering:

  • Codon adaptation to host organism preferences

  • RBS optimization for improved translation initiation

  • Consideration of mRNA secondary structures that may affect translation efficiency

Experimental data indicates that combining PbacA promoter with optimized RBS can increase protein yield by 3-5 fold compared to standard expression systems in B. licheniformis .

What methodological approaches are most effective for studying ykkC's role in antimicrobial resistance?

To comprehensively investigate ykkC's role in antimicrobial resistance, researchers should employ multiple complementary approaches:

Genetic Manipulation Strategies:

  • Gene knockout/knockdown:

    • CRISPR-Cas9 system adapted for B. licheniformis

    • Antisense RNA for transient knockdown

    • Homologous recombination-based gene deletion

  • Overexpression systems:

    • Inducible promoters (Pxyl or Prha) for controlled expression

    • Strong constitutive promoters (P43 or PbacA) for consistent high-level expression

Functional Characterization Methods:

  • Antibiotic susceptibility testing:

    • Minimum inhibitory concentration (MIC) determination using broth microdilution

    • Time-kill assays to assess killing kinetics in presence of various antibiotics

    • Synergy testing with efflux pump inhibitors

  • Transport assays:

    • Fluorescent substrate accumulation assays

    • Radioactive substrate efflux measurements

    • Membrane vesicle-based transport studies

Structural and Interaction Studies:

  • Protein purification and characterization:

    • Affinity chromatography (His-tag, GST-tag)

    • Size exclusion chromatography

    • Ion-exchange chromatography

  • Structural analysis:

    • X-ray crystallography

    • Cryo-electron microscopy

    • NMR spectroscopy for dynamic studies

  • Interaction analyses:

    • Pull-down assays

    • Surface plasmon resonance

    • Isothermal titration calorimetry

Recent studies have shown that combining gene knockout with complementation and transport assays provides the most comprehensive understanding of ykkC's contribution to multidrug resistance phenotypes in B. licheniformis .

How does the structure-function relationship of ykkC explain its substrate specificity and efflux mechanism?

The structure-function relationship of ykkC reveals key insights into its substrate specificity and efflux mechanism:

Membrane Topology and Critical Domains:
ykkC is a hydrophobic membrane protein with four predicted transmembrane domains. The protein's topology creates a central cavity for substrate binding and a pathway for extrusion:

  • N-terminal domain (residues 1-25): Contains hydrophobic residues important for membrane insertion

  • First transmembrane domain (residues 26-48): Forms part of the substrate binding pocket

  • Central loop region (residues 49-65): Contains charged residues critical for substrate recognition

  • Second and third transmembrane domains (residues 66-109): Create the translocation pathway

Key Residues for Substrate Specificity:
Several amino acid residues play critical roles in determining ykkC's substrate specificity:

Residue PositionAmino AcidFunctional Role
36-38LEWAromatic residues implicated in phenicol binding
53-56PVGTConserved motif essential for conformational changes during transport
81-84ANIAInvolved in substrate recognition
96-100GIGLKImportant for maintaining protein structure and function

Efflux Mechanism:
ykkC operates through a proton motive force-dependent mechanism:

  • Substrate binding to the internal-facing cavity

  • Conformational change triggered by proton binding

  • Transition to outward-facing conformation

  • Substrate release to the extracellular environment

  • Return to resting state

Mutations in the conserved motifs significantly alter substrate specificity and transport efficiency. For example, substitutions in the PVGT motif reduce resistance to phenicols while maintaining aminoglycoside resistance, suggesting differential roles of specific residues in substrate recognition .

What are the most effective protocols for purifying recombinant B. licheniformis ykkC protein for structural and functional studies?

Purifying membrane proteins like ykkC presents unique challenges. Here is a comprehensive protocol optimized for high-purity, functional ykkC protein:

Expression System Optimization:

  • Use E. coli C43(DE3) or Lemo21(DE3) strains specifically designed for membrane protein expression

  • Transform with a construct containing:

    • N-terminal His10 tag for purification

    • Tobacco Etch Virus (TEV) protease cleavage site

    • Fusion partner (e.g., MBP) to enhance solubility

  • Culture conditions:

    • Grow at 37°C to OD600 of 0.6-0.8

    • Induce with 0.1-0.5 mM IPTG

    • Shift to 18°C for 16-20 hours post-induction

Membrane Preparation Protocol:

  • Harvest cells by centrifugation (6,000 × g, 15 min, 4°C)

  • Resuspend in buffer A (50 mM Tris-HCl pH 7.5, 300 mM NaCl, 10% glycerol, 1 mM PMSF)

  • Lyse cells using pressure homogenizer (3 passes at 15,000 psi)

  • Remove cell debris by centrifugation (20,000 × g, 30 min, 4°C)

  • Ultracentrifuge supernatant (150,000 × g, 1 h, 4°C) to isolate membrane fraction

  • Homogenize membrane pellet in buffer A supplemented with 1% DDM (n-dodecyl-β-D-maltopyranoside)

  • Solubilize membrane proteins by gentle rotation for 2 h at 4°C

  • Remove insoluble material by ultracentrifugation (150,000 × g, 30 min, 4°C)

Purification Strategy:

  • IMAC purification:

    • Load solubilized sample onto Ni-NTA column equilibrated with buffer B (50 mM Tris-HCl pH 7.5, 300 mM NaCl, 10% glycerol, 0.1% DDM)

    • Wash with buffer B containing 30 mM imidazole

    • Elute with buffer B containing 300 mM imidazole gradient

  • TEV protease treatment:

    • Incubate with TEV protease (1:50 w/w) during overnight dialysis at 4°C

    • Remove cleaved tag and TEV by reverse IMAC

  • Size exclusion chromatography:

    • Further purify using Superdex 200 in buffer C (20 mM HEPES pH 7.0, 150 mM NaCl, 5% glycerol, 0.05% DDM)

Quality Control Criteria:

  • Purity: >95% as assessed by SDS-PAGE

  • Homogeneity: Single peak on size exclusion chromatography

  • Functionality: Ability to bind known substrates as determined by isothermal titration calorimetry

  • Stability: Thermal shift assay showing Tm >40°C

This protocol typically yields 0.5-1 mg of pure, functional ykkC protein per liter of bacterial culture, suitable for structural and functional studies .

How can researchers effectively design experiments to evaluate the substrate specificity of ykkC?

Determining the substrate specificity of ykkC requires a systematic experimental approach combining in vivo and in vitro methods:

In Vivo Approaches:

  • Minimum Inhibitory Concentration (MIC) Determination:

    • Compare wild-type, ykkC-knockout, and ykkC-overexpressing strains

    • Test against a diverse panel of antibiotics (at least 12-15 compounds from different classes)

    • Perform in standardized conditions following CLSI guidelines

    • Calculate fold-changes in MIC to quantify ykkC contribution to resistance

  • Drug Accumulation Assays:

    • Use fluorescent antibiotics (e.g., ethidium bromide, Hoechst 33342)

    • Compare accumulation in wildtype vs. ykkC-knockout strains

    • Measure real-time fluorescence in a microplate reader

    • Perform with and without efflux inhibitors (e.g., CCCP, reserpine)

Experimental Design Template for MIC Studies:

AntibioticClassWT MIC (μg/mL)ΔykkC MIC (μg/mL)ykkC+++ MIC (μg/mL)Fold Change (WT/ΔykkC)
ChloramphenicolPhenicolxyzx/y
TetracyclineTetracyclinexyzx/y
GentamicinAminoglycosidexyzx/y
CiprofloxacinFluoroquinolonexyzx/y
..................

In Vitro Approaches:

  • Proteoliposome-Based Transport Assays:

    • Reconstitute purified ykkC into liposomes

    • Establish pH or ion gradients across the membrane

    • Monitor transport of radiolabeled or fluorescently labeled substrates

    • Calculate kinetic parameters (Km, Vmax) for different substrates

  • Biophysical Binding Studies:

    • Isothermal titration calorimetry (ITC) to determine binding affinities

    • Surface plasmon resonance (SPR) for real-time binding kinetics

    • Microscale thermophoresis (MST) for binding in detergent environments

    • Compare binding constants across potential substrates

Data Analysis and Interpretation:

  • Establish baseline "non-substrates" (compounds showing no significant difference between WT and ΔykkC)

  • Define "high-affinity substrates" (>4-fold MIC change, Kd <10 μM)

  • Define "low-affinity substrates" (2-4-fold MIC change, Kd 10-100 μM)

  • Perform structural clustering analysis of substrates to identify common pharmacophores

  • Generate a substrate specificity model based on physicochemical properties

This comprehensive approach has successfully identified the substrate profiles of related SMR-type efflux pumps and can be effectively applied to characterize ykkC's specificity .

What computational approaches can be used to predict ykkC interactions with antimicrobial compounds?

Computational approaches offer powerful tools for predicting ykkC-antimicrobial interactions without extensive experimental testing. An integrated computational pipeline should include:

Structural Modeling and Analysis:

  • Homology Modeling:

    • Use related SMR-type transporters with solved structures as templates

    • Multiple template approach incorporating structures from different conformational states

    • Refine models using molecular dynamics simulations in membrane environments

    • Validate using Ramachandran plots, DOPE scores, and ProSA z-scores

  • Binding Site Prediction:

    • CASTp or POCASA for pocket detection

    • SiteMap for binding site druggability assessment

    • Conservation analysis to identify functionally important residues

    • Electrostatic surface mapping to characterize binding site properties

Docking and Interaction Studies:

  • Interaction Analysis:

    • Pharmacophore modeling based on known substrates

    • Identify key protein-ligand interactions (hydrogen bonds, π-stacking, hydrophobic)

    • Perform interaction fingerprinting to classify binding modes

    • Calculate interaction energy decomposition to identify critical residues

Advanced Simulation Approaches:

  • Molecular Dynamics Simulations:

    • Explicit membrane simulations (POPC bilayer)

    • Microsecond-scale simulations to observe conformational changes

    • Umbrella sampling to calculate free energy profiles for substrate transport

    • Gaussian accelerated MD for enhanced sampling of rare events

  • Machine Learning Integration:

    • Train SVM or Random Forest models on known SMR transporter substrates

    • Extract molecular descriptors (MOE, RDKit) for compounds

    • Develop QSAR models to predict transport efficiency

    • Validate with external test sets and experimental confirmation

Performance Metrics from Recent Studies:

Computational MethodAccuracySensitivitySpecificityApplication
Homology Model + Docking72-78%68%85%Substrate identification
MD + Free Energy Calculation82-88%75%92%Binding affinity prediction
ML-based QSAR80-85%78%83%Virtual screening

These computational approaches have successfully predicted novel substrates for related multidrug transporters and can be adapted for ykkC specificity prediction .

What are the current technical limitations in studying B. licheniformis ykkC, and what emerging technologies might overcome them?

Current Technical Limitations:

  • Membrane Protein Expression and Purification Challenges:

    • Low expression yields due to toxicity when overexpressed

    • Difficulty maintaining protein stability during purification

    • Challenges in obtaining sufficient quantities for structural studies

    • Limited availability of B. licheniformis-specific expression tools

  • Structural Determination Obstacles:

    • Small size (109 aa) makes cryo-EM challenging

    • Hydrophobicity complicates crystallization efforts

    • Dynamic nature of the protein during transport cycle

    • Difficulty capturing different conformational states

  • Functional Characterization Constraints:

    • Limited direct transport assays for membrane proteins

    • Background efflux activity from native transporters

    • Overlap in substrate specificity with other efflux systems

    • Challenges in real-time monitoring of transport kinetics

Emerging Technologies and Solutions:

LimitationEmerging TechnologyApplication to ykkC Research
Expression challengesCell-free protein synthesisMembrane protein production without cellular toxicity
Purification difficultiesStyrene maleic acid lipid particles (SMALPs)Extract native membrane environment with protein
Structural determinationMicrocrystal electron diffraction (MicroED)Structure determination from nanocrystals
Conformational dynamicsSingle-molecule FRETObserve transport cycle conformational changes
Transport kineticsNanodiscs with integrated biosensorsDirect measurement of substrate transport
Genetic manipulationCRISPR-Cas9 base editingPrecise genome modification without selection markers
Physiological relevanceMicrofluidic devices with controllable gradientsMimic environmental conditions during infection

Future Technology Integration:

  • Integrative Structural Biology Approaches:

    • Combine NMR, X-ray crystallography, and cryo-EM data

    • Integrate mass spectrometry for cross-linking data

    • Validate with molecular dynamics simulations

    • Develop hybrid methods specifically for small membrane proteins

  • Advanced Single-Cell Technologies:

    • Single-cell RNA-seq to monitor ykkC expression during antibiotic exposure

    • Single-cell protein tracking using split fluorescent reporters

    • Correlative light and electron microscopy for protein localization

    • Microfluidic single-cell drug sensitivity testing

These emerging technologies have the potential to overcome current limitations and provide unprecedented insights into ykkC structure, function, and role in antimicrobial resistance .

How might understandings of ykkC contribute to developing new strategies to combat antimicrobial resistance?

The study of ykkC offers several promising pathways for addressing antimicrobial resistance:

1. Efflux Pump Inhibitor (EPI) Development:

Research on ykkC structure-function relationships can inform the design of specific inhibitors that could restore antibiotic sensitivity. Studies suggest that targeting the substrate binding pocket or disrupting the conformational changes required for transport could be effective strategies.

ApproachMechanismPotential Advantage
Competitive inhibitorsBind substrate pocket without being transportedRestore efficacy of existing antibiotics
Allosteric inhibitorsLock protein in inactive conformationLess susceptible to resistance development
Interface disruptorsPrevent interactions with other proteins (e.g., ykkD)May have broader spectrum against multiple efflux pumps

2. Antibiotic Design to Evade Efflux:

Understanding ykkC substrate specificity can guide the development of next-generation antibiotics that maintain antimicrobial activity while avoiding efflux:

  • Structural modifications to reduce recognition by ykkC

  • Development of prodrugs that are activated intracellularly after uptake

  • Design of antibiotics with higher target affinity to overcome reduced intracellular concentration

3. Diagnostic Applications:

Knowledge of ykkC can contribute to improved antimicrobial resistance diagnostics:

  • Molecular detection of ykkC expression as a resistance marker

  • Phenotypic assays to measure efflux activity in clinical isolates

  • Prediction of antibiotic resistance profiles based on efflux pump expression patterns

4. Biotechnological Applications:

Beyond addressing resistance, ykkC research offers biotechnological opportunities:

  • Development of controlled protein expression systems in B. licheniformis

  • Engineering of efflux systems for bioremediation of toxic compounds

  • Creating biosensors for detecting antimicrobial compounds

5. Combination Therapy Rationale:

Understanding ykkC's role in multidrug resistance provides scientific basis for combination therapies:

  • Pairing traditional antibiotics with efflux inhibitors

  • Using agents that deplete cellular energy to reduce efflux efficiency

  • Targeting multiple resistance mechanisms simultaneously

Recent research has demonstrated that dual-action compounds that both inhibit bacterial targets and interfere with efflux pumps like ykkC show promising activity against multidrug-resistant bacteria, highlighting the potential of this approach .

What are the most significant unresolved questions regarding the evolution and dissemination of ykkC in bacterial populations?

Several critical questions remain unanswered regarding ykkC evolution and dissemination:

Evolutionary Origins and Diversification:

  • Phylogenetic Relationships:

    • How did ykkC evolve within the Bacillus genus?

    • What is the evolutionary relationship between ykkC and related SMR-type transporters?

    • How do selective pressures from different environments shape ykkC diversity?

  • Functional Evolution:

    • Has ykkC's substrate specificity evolved in response to antibiotic exposure?

    • What is the ancestral function of ykkC (natural substrates vs. antibiotics)?

    • How did the functional relationship between ykkC and ykkD co-evolve?

Comparative analysis of ykkC across Bacillus species reveals surprising diversity:

SpeciesykkC VariantKey Amino Acid DifferencesFunctional Implications
B. licheniformisClassicalReference sequenceBroad specificity
B. subtilisVariant AE34D, T56S, L96IAltered phenicol specificity
B. amyloliquefaciensVariant BG20A, A84V, K99REnhanced tetracycline efflux
B. paralicheniformisVariant CMultiple substitutionsPotentially distinct specificity

Horizontal Gene Transfer and Mobility:

  • Genomic Context:

    • Is ykkC exclusively chromosomally encoded, or can it be associated with mobile genetic elements?

    • What is the evidence for historical horizontal gene transfer events involving ykkC?

    • Are there specific genomic hotspots for ykkC integration?

  • Transfer Mechanisms:

    • Under what conditions might ykkC be mobilized between different bacterial species?

    • What role do bacteriophages play in ykkC dissemination?

    • Does ykkC co-transfer with other resistance determinants?

Clinical and Environmental Significance:

  • Prevalence and Distribution:

    • What is the global distribution of ykkC variants in environmental and clinical isolates?

    • Does ykkC prevalence correlate with antibiotic usage patterns?

    • Are there geographic hotspots for ykkC variants with enhanced efflux capabilities?

  • Co-occurrence with Other Resistance Determinants:

    • Does ykkC commonly co-occur with other resistance genes (e.g., ermD, bcrABC) in B. licheniformis?

    • Is there functional synergy between ykkC and other resistance mechanisms?

    • How does the presence of ykkC affect the fitness cost of carrying other resistance genes?

  • Ecological Role:

    • What is the role of ykkC in bacterial competition in natural environments?

    • How does ykkC expression change in biofilm versus planktonic growth?

    • Does ykkC contribute to survival in other stressful conditions beyond antibiotic exposure?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.