Recombinant Bacillus licheniformis Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Lgt and Its Biological Role

Prolipoprotein diacylglyceryl transferase (Lgt) is a membrane-bound enzyme essential for lipoprotein biosynthesis in bacteria. In Bacillus licheniformis, Lgt catalyzes the transfer of a diacylglyceryl moiety from phosphatidylglycerol to the conserved cysteine residue of prolipoproteins, forming a thioether bond. This modification is critical for anchoring lipoproteins to the cytoplasmic membrane, enabling their involvement in nutrient uptake, stress response, and virulence . Recombinant Lgt refers to the enzyme produced via genetic engineering, often for industrial or research applications such as antibiotic development or lipoprotein engineering .

Table 1: Key Features of B. licheniformis Lgt vs. Other Bacterial Lgt Enzymes

FeatureB. licheniformis LgtE. coli LgtB. subtilis Lgt
Transmembrane Domains777
Catalytic ResiduesY26, N146, G154*Y26, N146, G154Homologous residues
Lipoprotein AnchoringCytoplasmic membraneOuter membraneCytoplasmic membrane
EssentialityNon-essentialEssentialNon-essential

*Inferred from E. coli data .

Functional Insights from Research

  • Antibiotic Target: Lgt inhibitors (e.g., G2823, G2824) show bactericidal activity against Gram-negative pathogens by disrupting outer membrane integrity . While B. licheniformis Lgt itself is not a direct drug target, its study informs cross-species resistance mechanisms .

  • Lipoprotein Maturation: In B. licheniformis, Lgt depletion does not impair viability but reduces extracellular lipoprotein levels (e.g., OppA, PrsA), affecting nutrient uptake and stress tolerance .

  • Biochemical Assays: Activity is measured via glycerol phosphate release or SDS-PAGE analysis of lipoprotein intermediates .

Table 2: Applications of Recombinant Lgt

ApplicationExample Study OutcomeReference
Antibiotic DevelopmentLgt inhibitors effective against E. coli (IC50_{50} = 0.18–0.93 μM)
Lipoprotein EngineeringNon-lipidated PrsA retains foldase activity but shows reduced secretion
Industrial EnzymesB. licheniformis used for high-yield enzyme production (e.g., CGTase, α-amylase)

Challenges and Future Directions

  • Resistance Mechanisms: No on-target resistance reported for Lgt inhibitors, likely due to conserved active sites .

  • Structural Studies: Cryo-EM or X-ray crystallography of B. licheniformis Lgt could refine inhibitor design .

  • Biotechnological Optimization: Enhancing expression via promoter engineering (e.g., rhamnose-inducible systems) or CRISPR-based genome editing .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; BLi03745; BL03402; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)
Target Names
lgt
Target Protein Sequence
MNETIEPLNPIAFQLGPIAVHWYGIIIGLGALLGLWLAVREGERRGLHKDTFVDLVLFAI PIAILCARAYYVIFQWGYYSEHPDQIIQIWNGGLAIHGGLIGAVLTGIIYAKVKGLSFWK LADIAAPSILLGQAIGRWGNFMNQEAHGEAVSRAFLENLHLPDFIINQMYIDGQYYQPTF LYESLWSFTGVVVLLLLRKANLKRGELFLIYVIWYSMGRYFIEGLRTDSLMLTENLRIAQ VISIVLILCAAALIAYRRFKGREIKRYQEM
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, the first step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of Prolipoprotein diacylglyceryl transferase (lgt) in Bacillus licheniformis?

Prolipoprotein diacylglyceryl transferase (lgt) in Bacillus licheniformis is an essential enzyme that catalyzes the first step in bacterial lipoprotein biosynthesis. Specifically, lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to the conserved cysteine residue in the lipobox motif of prelipoproteins. This reaction is critical for membrane anchoring of lipoproteins, which have their lipid moieties anchored in the outer layer of the cytoplasmic membrane while their protein portions span the cell wall .

The biosynthetic pathway for lipoproteins in B. licheniformis involves multiple enzymatic steps that appear to be highly conserved across bacterial species. After lgt performs the initial lipid transfer, signal peptidase II (Lsp) cleaves the signal peptide to expose the modified N-terminal cysteine. This process is crucial for proper lipoprotein localization and function. In Gram-positive bacteria like B. licheniformis, lipoproteins play diverse roles including nutrient uptake, enzymatic activities, and cell wall maintenance .

Without functional lgt, bacteria cannot properly anchor lipoproteins to the membrane, leading to significant physiological consequences including impaired nutrient acquisition, compromised membrane integrity, and potential defects in cellular processes that depend on properly localized lipoproteins.

What are the optimal expression systems for producing recombinant B. licheniformis lgt?

Expressing recombinant B. licheniformis lgt presents significant challenges due to its nature as an integral membrane protein. Several expression systems can be considered, each with distinct advantages:

  • Homologous expression in B. licheniformis offers the most native environment for proper folding and post-translational modifications. This approach can leverage endogenous strong promoters such as P_bacA (derived from the bacitracin synthase operon) for high-level expression . The native cellular machinery ensures proper membrane insertion and folding, maximizing the likelihood of obtaining functional enzyme.

  • Expression in closely related B. subtilis represents another effective approach. B. subtilis shares significant genetic similarity with B. licheniformis and offers well-established genetic tools and protocols . Strong promoters derived from various metabolic pathways can drive high-level expression while maintaining proper protein processing.

  • E. coli-based expression systems, particularly strains engineered for membrane protein production (such as C41/C43), provide a more accessible but potentially less optimal environment. While easier to manipulate genetically, E. coli may not properly fold or process B. licheniformis proteins, potentially resulting in reduced enzymatic activity.

The optimal expression strategy should consider the intended application. For structural studies requiring large quantities of purified protein, E. coli systems might be preferable despite potential activity loss. For functional studies demanding fully active enzyme, homologous expression in Bacillus species generally yields superior results, despite more challenging genetic manipulation.

What methods can detect and measure lgt enzymatic activity?

Developing robust assays to measure B. licheniformis lgt activity requires careful consideration of reaction conditions and detection methods. Several complementary approaches provide comprehensive insights into enzyme function:

  • Radioactive assays using labeled phospholipids represent the gold standard for measuring lgt activity. This approach typically employs [14C]-palmitate labeled phosphatidylglycerol as substrate and measures the transfer of radiolabeled diacylglyceryl to peptide substrates containing the lipobox motif . Following reaction completion, products are separated by thin-layer chromatography and quantified by autoradiography or scintillation counting. This method offers high sensitivity and direct quantification of the lipid transfer reaction.

  • Mass spectrometry-based assays provide precise molecular characterization of reaction products. By incubating lgt with phosphatidylglycerol and synthetic peptide substrates, then analyzing the reaction mixture by LC-MS/MS, researchers can directly detect the mass shift corresponding to diacylglyceryl addition. This approach offers excellent specificity and can identify reaction intermediates and variants in lipid modification.

  • Fluorescence-based assays enable continuous monitoring of reaction kinetics. These typically employ peptide substrates containing strategically placed fluorophore-quencher pairs that undergo spectral changes upon lipidation. Such assays are particularly valuable for high-throughput inhibitor screening or enzyme variant characterization.

Optimal reaction conditions for B. licheniformis lgt activity typically include pH 7.0-8.0, temperature 30-37°C, presence of divalent cations (particularly Mg2+), and appropriate detergent concentrations to maintain enzyme solubility while enabling substrate accessibility. Each parameter requires careful optimization to ensure maximum activity preservation.

How can purified recombinant B. licheniformis lgt be used in structural studies?

Obtaining structural information about B. licheniformis lgt presents significant challenges typical of integral membrane proteins. Several approaches can overcome these barriers:

  • X-ray crystallography remains the gold standard for atomic-resolution structures but requires well-diffracting crystals. For membrane proteins like lgt, this typically involves solubilization in appropriate detergents followed by crystallization trials. The use of lipidic cubic phase crystallization has revolutionized membrane protein structural biology and represents a promising approach for lgt. Additionally, co-crystallization with substrate analogs, inhibitors, or antibody fragments can stabilize the protein and facilitate crystal formation.

  • Cryo-electron microscopy (cryo-EM) offers an increasingly powerful alternative that doesn't require crystal formation. For lgt, preparation would involve purification in detergent micelles or reconstitution into nanodiscs before vitrification and imaging. Recent advances in direct electron detectors and image processing have enabled near-atomic resolution of membrane proteins smaller than 100 kDa, making lgt a potentially suitable target.

  • Nuclear magnetic resonance (NMR) spectroscopy can provide valuable structural and dynamic information, particularly for specific domains or in combination with other methods. While complete structure determination of full-length lgt by NMR would be challenging, targeted studies of specific regions can complement other structural approaches.

Each method requires carefully optimized protein purification protocols to maintain structural integrity. Typically, this involves membrane extraction with mild detergents such as n-dodecyl-β-D-maltoside (DDM), followed by affinity chromatography and size exclusion chromatography in buffers containing detergent concentrations just above the critical micelle concentration (CMC) to minimize micelle size while preventing protein aggregation.

What approaches can identify and characterize inhibitors of B. licheniformis lgt?

The development of lgt inhibitors represents a promising avenue for novel antimicrobial agents. Several complementary approaches can identify and characterize potential inhibitors:

  • High-throughput screening of compound libraries using activity-based assays provides an efficient starting point. Fluorescence-based assays monitoring the lgt-catalyzed reaction in real-time are particularly suitable for screening large collections of compounds. Primary hits can then be validated using orthogonal assays such as radioactive lipid transfer measurements to confirm target engagement.

  • Structure-based design approaches leverage computational methods to identify compounds likely to bind the lgt active site. While the exact structure of B. licheniformis lgt remains undetermined, homology models based on related proteins can guide virtual screening campaigns. Fragment-based approaches, which identify small molecular scaffolds that bind to different regions of the protein and can later be linked, offer an alternative strategy particularly suited for challenging targets like membrane proteins.

  • Rational design of substrate analogs represents another productive approach. Compounds that mimic either the phospholipid substrate or the lipobox motif of prelipoproteins can potentially compete with natural substrates. Phospholipid analogs with modified headgroups or altered acyl chains may act as competitive inhibitors, while peptidomimetics based on the lipobox consensus sequence might block the prelipoprotein binding site.

  • Phenotypic screening for compounds that produce similar effects to lgt deletion can identify inhibitors through their functional consequences rather than direct enzyme inhibition. Such compounds would be expected to reduce surface hydrophobicity and impair spore germination in a manner similar to genetic lgt deletion .

Promising inhibitor candidates should be characterized for their mechanism of action, specificity, cytotoxicity, and antibacterial activity against whole cells. The most valuable inhibitors would selectively target bacterial lgt without affecting mammalian enzymes and demonstrate bactericidal activity against relevant pathogens.

How can CRISPR-Cas9 be used to engineer B. licheniformis lgt for biotechnological applications?

CRISPR-Cas9 technology offers powerful approaches for precisely engineering B. licheniformis lgt for various biotechnological applications:

  • Enhanced catalytic efficiency can be achieved through targeted modification of active site residues. By designing guide RNAs targeting specific regions of the lgt gene and providing donor DNA templates containing desired mutations, researchers can introduce precise changes that optimize catalytic parameters. Potential targets include residues involved in substrate binding, catalytic activity, or protein stability. The resulting engineered enzymes might display increased turnover rates, altered substrate preferences, or enhanced stability under industrial conditions.

  • Substrate specificity engineering enables creation of lgt variants capable of transferring modified lipid moieties to prelipoproteins. By targeting the phospholipid binding pocket or substrate recognition regions, researchers can potentially develop enzymes that incorporate non-natural lipids with useful properties. Such engineered lgt variants could facilitate production of lipoproteins with novel functions, including enhanced immunogenicity for vaccine applications or altered membrane anchoring characteristics.

  • Expression optimization through promoter engineering can maximize production of recombinant lgt. B. licheniformis offers diverse promoter systems that can be engineered for improved performance . CRISPR-based approaches can modify endogenous promoters or precisely insert optimized synthetic promoters to control lgt expression levels. Additionally, ribosome binding site (RBS) engineering can fine-tune translation efficiency to achieve desired protein production levels .

  • Conditional activity systems can be developed by incorporating regulatory domains or environmental sensing elements. This approach enables creation of B. licheniformis strains that produce active lgt only under specific conditions, facilitating controlled lipoprotein processing for specialized applications.

Successful implementation of these strategies requires efficient CRISPR-Cas9 delivery into B. licheniformis, appropriate screening methods to identify desired modifications, and thorough characterization of engineered variants. The resulting enhanced lgt enzymes could find applications in protein display technology, vaccine development, and production of functionalized lipoproteins for diverse biotechnological purposes.

What role does membrane lipid composition play in modulating lgt activity?

The lipid composition of the bacterial membrane significantly influences lgt activity through multiple mechanisms:

  • Substrate availability represents the most direct effect of membrane composition on lgt function. As the enzyme transfers diacylglyceryl from phosphatidylglycerol to prelipoproteins, the concentration and accessibility of phosphatidylglycerol within the membrane directly impacts reaction rates. Environmental conditions or genetic modifications that alter phospholipid composition can therefore significantly affect lgt activity by modulating substrate concentration in the enzyme's vicinity.

  • Membrane physical properties exert profound effects on integral membrane proteins like lgt. Properties such as fluidity, thickness, curvature, and lateral pressure profile influence enzyme conformation and dynamics. For example, changes in membrane fluidity—whether due to temperature fluctuations, altered fatty acid composition, or presence of membrane-active compounds—can affect the mobility of both enzyme and substrates within the bilayer, thereby modulating catalytic efficiency.

  • Localized lipid environments surrounding the enzyme may differ from bulk membrane composition. Evidence from other bacterial systems suggests that certain enzymes preferentially localize to specific lipid domains or "rafts" with distinct compositions. The presence and composition of such microdomains may regulate lgt activity by creating optimized local environments for catalysis or by sequestering the enzyme from its substrates.

  • Lipid-protein interactions beyond the active site can allosterically regulate enzyme function. Specific lipid species may bind to regulatory sites on lgt, inducing conformational changes that enhance or inhibit catalytic activity. Additionally, the hydrophobic matching between transmembrane domains and the surrounding lipid bilayer influences protein stability and function.

Understanding these lipid-enzyme interactions provides valuable insights for optimizing in vitro activity assays and interpreting phenotypic effects of mutations or environmental stresses. Furthermore, this knowledge can inform strategies for manipulating lgt activity in biotechnological applications through engineered alterations to membrane composition.

How can lipoprotein modifications by lgt be utilized in vaccine development?

Lipoproteins processed by lgt offer significant potential for vaccine development through several mechanisms:

  • Enhanced immunogenicity represents the primary advantage of lipidated antigens. The diacylglyceryl modification attached by lgt serves as a potent pathogen-associated molecular pattern (PAMP) recognized by Toll-like receptor 2 (TLR2) on immune cells . This recognition triggers robust innate immune responses, including production of pro-inflammatory cytokines and enhanced antigen presentation. Consequently, lipidated antigens typically elicit stronger antibody responses and more effective T cell activation than their non-lipidated counterparts.

  • Attenuated strains with modified lgt function offer promising live vaccine candidates. As demonstrated in B. anthracis, lgt mutant spores show markedly attenuated virulence while maintaining antigen expression . Such strains could potentially serve as safe, effective live vaccines that stimulate comprehensive immune protection without causing disease. The reduced TLR2-dependent TNF-α response observed with lgt mutants might also help balance immunogenicity with acceptable reactogenicity profiles .

  • Recombinant lipoproteins produced using engineered B. licheniformis expression systems provide a controlled approach to vaccine antigen production. By co-expressing lgt alongside selected antigens with appropriate lipobox motifs, researchers can generate consistently lipidated proteins with defined modifications. The strong promoters and secretion capabilities of B. licheniformis make it particularly suitable for such applications .

  • Modular vaccine design becomes possible through controlled lipoprotein engineering. The lipobox motif can be genetically fused to various antigen sequences, creating chimeric proteins that combine the immunostimulatory properties of bacterial lipoproteins with the protective epitopes of selected pathogens. Such constructs can be produced in B. licheniformis and purified for use as subunit vaccines.

Implementation of these approaches requires careful optimization of expression systems, purification protocols that preserve the lipid modifications, and comprehensive immunological evaluation. The resulting lipidated vaccine candidates offer potential advantages in terms of immunogenicity, durability of protection, and dose-sparing effects compared to conventional subunit vaccines.

What purification strategies maintain lgt stability and activity?

Purifying recombinant B. licheniformis lgt presents significant challenges due to its integral membrane nature. Effective purification while preserving enzymatic activity requires carefully optimized protocols:

  • Membrane extraction and solubilization represents the critical first step. Gentle detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin effectively solubilize membrane proteins while preserving native conformation. A typical protocol involves resuspending membrane fractions in buffer containing 1-2% detergent, followed by incubation at 4°C for 1-2 hours with gentle agitation. The inclusion of glycerol (10-20%) and physiological salt concentrations (300-500 mM NaCl) helps stabilize the solubilized protein. Incomplete solubilization risks leaving active enzyme in the insoluble fraction, while excessive detergent concentrations may denature the protein.

  • Affinity chromatography enables selective capture of tagged recombinant lgt from the complex solubilized membrane extract. For histidine-tagged constructs, immobilized metal affinity chromatography using Ni-NTA or TALON resins provides efficient purification. Critical parameters include maintaining detergent concentrations above the critical micelle concentration (CMC) throughout all chromatography steps to prevent protein aggregation. Imidazole gradients rather than step elution often improve purity by differentiating between non-specific binding and genuine His-tagged protein.

  • Size exclusion chromatography serves as a valuable final purification step, separating monomeric lgt from aggregates and removing any remaining contaminants. Superdex 200 or similar matrices with appropriate fractionation ranges allow resolution of properly folded, detergent-solubilized lgt from higher molecular weight species. This step also facilitates buffer exchange to remove high imidazole concentrations from affinity chromatography while maintaining appropriate detergent levels.

  • Activity preservation requires careful consideration of buffer components. The inclusion of phospholipids (0.01-0.1 mg/ml) in purification buffers can significantly enhance stability by maintaining a lipid environment around the protein. Similarly, glycerol (10-15%) reduces protein denaturation during concentration and storage steps. Performing all purification procedures at 4°C with appropriate protease inhibitors minimizes degradation during the process.

Properly purified B. licheniformis lgt should retain significant enzymatic activity, as verified through activity assays comparing crude membrane fractions with purified protein. Storage conditions typically include flash-freezing in liquid nitrogen with cryoprotectants like glycerol to maintain long-term stability.

What expression vector systems are most effective for B. licheniformis lgt production?

Selecting appropriate vector systems for B. licheniformis lgt expression requires careful consideration of promoter strength, induction mechanisms, and host compatibility:

  • E. coli expression systems offer practical advantages for initial studies despite potential limitations in proper folding. pET series vectors under control of the T7 promoter provide high-level expression when induced with IPTG. For membrane proteins like lgt, modified E. coli hosts such as C41(DE3) or C43(DE3) often improve expression by better tolerating membrane protein overproduction. Vectors incorporating the pelB or other leader sequences can enhance membrane targeting. Codon optimization of the B. licheniformis lgt sequence for E. coli expression may improve translation efficiency.

  • Bacillus expression systems provide more native environments for proper folding and processing. For B. subtilis expression, shuttle vectors containing both E. coli and Bacillus origins of replication facilitate genetic manipulation. Strong, controllable promoters like P_spac or P_xylA offer regulated expression upon induction with IPTG or xylose, respectively. Signal sequences derived from native Bacillus secreted proteins can improve membrane targeting.

  • Homologous expression in B. licheniformis represents the optimal approach for obtaining fully functional enzyme. Based on recent advances in B. licheniformis promoter engineering, several promoter options show promising results . The P_bacA promoter derived from the bacitracin synthase operon provides strong constitutive expression . Alternatively, the acetoin-inducible promoter P_aco offers controlled expression that activates when glucose is depleted from the medium . For tightly regulated expression, the rhamnose-inducible promoter P_rha provides induction specifically in response to rhamnose addition .

  • Vector design considerations should include appropriate selection markers (antibiotic resistance genes compatible with the host organism), optimized ribosome binding sites for efficient translation initiation, and convenient restriction sites for cloning. For purification purposes, vectors encoding affinity tags (His6, Strep-tag II, or FLAG) facilitate downstream processing. Careful placement of these tags (N-terminal, C-terminal, or internal) may be necessary to preserve enzyme function.

Ultimately, the most effective expression system depends on the specific research objectives. For structural studies requiring large quantities of protein, E. coli systems might be preferred despite potential compromises in activity. For functional studies demanding fully active enzyme, homologous expression in B. licheniformis generally yields superior results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.