Recombinant Bacillus licheniformis Protein CrcB homolog 1 (crcB1)

Shipped with Ice Packs
In Stock

Description

Gene Information and Classification

CrcB homolog 1 (crcB1) is encoded by a specific gene in the Bacillus licheniformis genome. The gene is identified by several alternative designations in databases:

Database IdentifierDesignation
Gene NamecrcB1
SynonymsBLi01032, BL02845
Functional DescriptionPutative fluoride ion transporter CrcB 1
UniProt IDQ65LX4

The crcB1 gene belongs to the broader crcB family, which is distinct from other ion transport protein families such as the CLC (chloride channel) family. While CLC proteins often function as chloride channels or chloride/proton antiporters, crcB family proteins specifically specialize in fluoride transport .

Role in Fluoride Resistance

CrcB homolog 1 from Bacillus licheniformis plays a crucial role in fluoride resistance mechanisms. Fluoride ions can be toxic to bacterial cells at certain concentrations, and bacteria have evolved specific strategies to mitigate this toxicity. Research has demonstrated that crcB family proteins function as fluoride exporters, actively transporting fluoride ions out of the bacterial cytoplasm to maintain intracellular fluoride concentrations below toxic thresholds .

Experimental evidence supporting this function comes from studies showing that deletion of crcB genes renders bacteria hypersensitive to fluoride. For instance, when crcB is deleted in Escherichia coli (ΔcrcB strain), the bacteria become highly susceptible to fluoride toxicity, with growth almost completely arrested at fluoride concentrations as low as 0.5 mM, while wild-type E. coli remains unaffected even at 5 mM fluoride . This observation underscores the critical role of crcB proteins in fluoride resistance.

Transport Mechanism

The mechanism by which CrcB homolog 1 transports fluoride differs from other ion transporters like the CLC family. While certain CLC proteins function as chloride/proton antiporters with a 2:1 stoichiometry, the transport mechanism of crcB proteins appears to be specialized for fluoride ions . The structural features of crcB proteins, including their transmembrane domains, facilitate the selective recognition and transport of fluoride ions across the bacterial cell membrane.

Research has shown that when crcB genes from various bacterial species are expressed in fluoride-sensitive ΔcrcB E. coli strains, they restore fluoride resistance, confirming their conserved function across bacterial species . This suggests that the Bacillus licheniformis CrcB homolog 1 likely maintains the core fluoride transport functionality characteristic of this protein family.

Comparison with Other Transport Systems

CrcB proteins represent a distinct class of transporters compared to the more extensively studied CLC family. While CLCs often transport chloride or other anions, CrcB family proteins show specificity for fluoride. This specialization is reflected in experimental findings showing that chloride transporters like CLC-ec1 fail to rescue fluoride sensitivity in ΔcrcB strains, consistent with their selectivity for chloride over fluoride .

Some key differences between crcB and CLC transporters include:

  1. Substrate specificity: crcB shows higher selectivity for fluoride, while CLCs typically prefer chloride

  2. Structural features: crcB proteins lack conserved residues that form the anion binding site in canonical CLCs

  3. Transport mechanism: Some CLC F transporters (a subclass of CLCs) function as F-/H+ antiporters with a 1:1 stoichiometry, which differs from the 2:1 anion:proton coupling ratio typical of other CLC transporters

Expression Systems

The recombinant Bacillus licheniformis CrcB homolog 1 protein is typically produced using Escherichia coli expression systems . E. coli provides several advantages for recombinant protein production, including rapid growth, high protein yields, and well-established genetic manipulation techniques. The use of E. coli for expressing Bacillus proteins is a common strategy that enables efficient production of bacterial proteins for research and commercial applications.

For optimal expression, the crcB1 gene from Bacillus licheniformis is often cloned into specialized expression vectors containing promoters that allow controlled induction of protein expression. The addition of a polyhistidine tag (His-tag) at the N-terminus facilitates subsequent purification while minimally affecting protein function .

Purification and Quality Control

The purification of recombinant CrcB homolog 1 protein typically involves the following steps:

  1. Bacterial cell cultivation and induction of protein expression

  2. Cell lysis to release the expressed protein

  3. Affinity chromatography using the His-tag to selectively capture the target protein

  4. Additional purification steps as needed to achieve high purity

  5. Quality control verification, typically by SDS-PAGE analysis

Commercial preparations of this protein often achieve purity levels greater than 90% as determined by SDS-PAGE analysis . The purified protein is typically provided in a lyophilized form with a defined buffer composition to maintain stability.

Functional Studies of Fluoride Transport

Recombinant CrcB homolog 1 protein serves as a valuable tool for investigating fluoride transport mechanisms in bacteria. By reconstituting the purified protein into liposomes, researchers can study its transport properties, ion selectivity, and kinetics under controlled conditions. Such studies contribute to our understanding of how bacteria regulate intracellular fluoride concentrations and resist fluoride toxicity.

The availability of purified recombinant protein facilitates various experimental approaches, including:

  1. Proteoliposome-based transport assays to measure fluoride flux

  2. Binding studies to identify potential inhibitors or modulators

  3. Structural studies to elucidate the molecular basis of fluoride selectivity and transport

Gene Editing and Engineering Applications

The CRISPR-Cpf1 gene editing system has been successfully established in Bacillus licheniformis, providing a powerful tool for genetic manipulation of this industrially important bacterium . This technological advancement enables precise genetic modifications, including the study of crcB1 function through targeted gene knockout or modification.

The application of CRISPR-Cpf1 in B. licheniformis has achieved impressive gene editing efficiencies:

Gene Editing ApproachEfficiency
Single gene knockoutUp to 100%
Double gene knockoutUp to 80%

This genetic engineering capability facilitates functional studies of crcB1 through:

  1. Generation of crcB1 knockout strains to assess fluoride sensitivity

  2. Introduction of modified crcB1 variants to investigate structure-function relationships

  3. Regulation of crcB1 expression to study its impact on bacterial physiology

Industrial and Biotechnological Significance

Bacillus licheniformis is recognized as a significant industrial microorganism with applications in various biotechnological processes . Understanding the function of crcB1 in this organism contributes to our knowledge of how industrial strains adapt to environmental stresses, including fluoride exposure. This knowledge may inform strategies for improving strain robustness in industrial applications.

Potential biotechnological applications related to crcB1 include:

  1. Development of fluoride-resistant industrial strains for applications where fluoride exposure may occur

  2. Engineering of controlled fluoride transport systems for specific biotechnological processes

  3. Utilization of crcB1 as a selectable marker or reporter in genetic engineering applications

Fluoride Resistance Studies

Research on crcB family proteins has provided compelling evidence for their role in fluoride resistance. Experimental studies have demonstrated that wild-type E. coli strains containing functional crcB genes exhibit normal growth in media containing up to 5 mM fluoride. In contrast, ΔcrcB strains lacking these genes show severe growth inhibition at just 0.5 mM fluoride .

The rescue of fluoride sensitivity through heterologous expression of crcB genes from various bacterial species, including those related to the Bacillus licheniformis CrcB homolog 1, provides strong support for the conserved function of these proteins as fluoride transporters. When ΔcrcB E. coli strains are transformed with rescue vectors bearing CLC F homologues (a related class of fluoride transporters), they regain the ability to grow in fluoride-containing media .

Transport Mechanism Investigations

Studies investigating the transport mechanism of fluoride transporters have revealed several distinctive features:

  1. High selectivity for fluoride over chloride ions

  2. Proton-coupled transport in some cases, particularly in CLC F proteins

  3. Unique structural features that distinguish fluoride transporters from chloride transporters

Research using reconstituted proteoliposomes has enabled direct observation of fluoride transport activity. In these experiments, proteoliposomes loaded with KF show time-dependent changes in fluoride distribution when exposed to specific conditions, providing direct evidence of transporter-mediated fluoride movement across membranes .

Genetic Characterization

Recent advances in gene editing technology, particularly the establishment of the CRISPR-Cpf1 system in B. licheniformis, provide powerful tools for further genetic characterization of crcB1 and related genes . This technology enables precise genome modifications with high efficiency, facilitating detailed investigation of gene function through targeted deletion, replacement, or modification.

Physiological Role in Bacillus licheniformis

While the general function of crcB proteins in fluoride transport has been established, the specific physiological role of CrcB homolog 1 in Bacillus licheniformis warrants further investigation. Key questions include:

  1. The natural sources of fluoride exposure for B. licheniformis in its ecological niches

  2. The regulation of crcB1 expression in response to environmental conditions

  3. The interaction of crcB1 with other stress response systems

  4. The potential role of fluoride transport in microbial competition or survival

Biotechnological Applications

The unique properties of CrcB homolog 1 as a fluoride transporter suggest potential biotechnological applications that could be explored in future research:

  1. Development of biosensors for fluoride detection

  2. Engineering of microorganisms for environmental remediation of fluoride contamination

  3. Enhancement of industrial strains for improved tolerance to fluoride-containing substrates or conditions

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
crcB1; BLi01032; BL02845; Putative fluoride ion transporter CrcB 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)
Target Names
crcB1
Target Protein Sequence
MMAAAFMIAGGIGSVLRFWLGNVLMAMIPRPRIPVSVMVINILGSFALGIFISLGIDNQT VSIVVGTGFFGGFTTFSTFSVEAVQLLAAKRVKASAVYILLTMAGSIGGFWAGSMLIP
Uniprot No.

Target Background

Function
CrcB1 plays a crucial role in reducing fluoride concentration within the cell, thereby mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • How can experimental design be optimized when studying CrcB1 function in B. licheniformis?

When investigating CrcB1 function in B. licheniformis, experimental design should adhere to fundamental scientific principles while addressing the specific challenges of membrane protein research. Based on established experimental design guidelines, the following framework is recommended:

  • Replication, randomization, and blocking: Implement these core principles as described by Johnson and Besselsen (2002) for robust experimental design . For CrcB1 studies, biological replicates should include independent transformants when studying genetic modifications.

  • Control selection: Include both wild-type strains and strains with knockouts of unrelated membrane proteins (not involved in fluoride transport) to distinguish specific CrcB1 effects from general membrane disruption effects.

  • Knockout approach: Utilize the CRISPR-Cpf1 system which has demonstrated 100% knockout efficiency for single genes in B. licheniformis . This is vastly superior to traditional methods which show extremely low homologous recombination efficiency in this organism.

  • Functional assays: Design growth assays under fluoride stress conditions (0-100 mM NaF gradient) to establish dose-response relationships. Compare wild-type, knockout, and complemented strains to establish causality.

  • Growth phase considerations: When measuring phenotypes or expression, analyze across multiple growth phases (logarithmic, transitional, and stationary) as B. licheniformis gene expression shows significant phase-dependent regulation .

A factorial design examining interactions between environmental conditions (pH, temperature, salt concentration) and CrcB1 function is recommended, as ion transporters often respond to multiple variables simultaneously. Statistical power analysis prior to experimentation will ensure sufficient replication to detect physiologically relevant differences.

  • What gene editing techniques are most efficient for manipulating the crcB1 gene in B. licheniformis?

For efficient engineering of the crcB1 gene in B. licheniformis, several cutting-edge gene editing techniques have emerged, with CRISPR-Cpf1 demonstrating superior efficiency:

Gene Editing SystemEfficiency in B. licheniformisAdvantagesLimitations
CRISPR-Cpf1100% for single gene knockoutSimple design, high efficiencyMore complex for multiple genes
CRISPR-Cas9Variable, lower than Cpf1Well-established protocolsLarger protein, potential toxicity
RecT recombinase10^5-fold enhancement in recombinationLess disruptive to genomeRequires optimized delivery
Traditional HRExtremely low efficiencySimplest approachIneffective for most applications

When implementing CRISPR-Cpf1 for crcB1 manipulation :

  • Use maltose-inducible promoter (Pmal) to control Cpf1 expression, providing tight regulation with minimal toxicity compared to other inducible systems.

  • Design crRNA to target unique sequences within crcB1, taking advantage of the shorter guide RNA requirements of Cpf1 compared to Cas9 sgRNA.

  • Construct homology-directed repair templates with 500-1000 bp homology arms flanking the target site to enhance recombination efficiency.

  • For verification, combine colony PCR with sequencing and functional assays (e.g., fluoride sensitivity tests) to confirm both genetic and phenotypic changes.

The CRISPR-Cpf1 system has overcome the limitations of traditional methods in B. licheniformis, which suffer from extremely low endogenous recombination efficiency that makes conventional approaches impractical .

  • How can transcriptome analysis be applied to understand CrcB1 regulation in B. licheniformis?

Transcriptome analysis offers powerful approaches to elucidate CrcB1 regulation in B. licheniformis, building on methodologies successfully applied to other genes in this organism:

  • RNA-seq experimental design: Implement strand-specific RNA sequencing (ssRNA-seq) across multiple growth phases, aiming for 45-60 million reads per sample as successfully used in previous B. licheniformis studies . This approach enables detection of both sense and antisense transcription at the crcB1 locus.

  • Differential expression analysis: Compare transcriptomes between wild-type and regulatory mutants (e.g., ΔAbrB strain) as global regulator knockouts can significantly alter membrane protein expression. Use statistical thresholds of adjusted p-value ≤ 0.05 and Fold Change(FC) ≥ 2 for identifying differentially expressed genes .

  • Co-expression network analysis: Implement co-abundant gene (CAG) clustering approaches to identify genes with correlated expression patterns to crcB1, revealing potential functional associations and regulatory networks .

  • Promoter analysis: Analyze the crcB1 promoter region for binding motifs of global regulators like AbrB or CcpA, which have been shown to influence numerous genes in B. licheniformis .

  • Validation: Confirm RNA-seq findings using quantitative real-time RT-PCR (qPCR) with primers specific to crcB1, normalizing against established B. licheniformis reference genes that remain stable across tested conditions .

This multi-faceted approach has successfully identified regulatory mechanisms for other B. licheniformis genes, including the bacitracin biosynthesis cluster, and can be adapted to understand crcB1 regulation in different environmental conditions and genetic backgrounds .

  • What is the potential role of CrcB1 in B. licheniformis stress response or antibiotic production?

While direct evidence specifically linking CrcB1 to stress response or antibiotic mechanisms in B. licheniformis is limited, several research approaches can elucidate its potential role:

  • Comparative analysis with characterized transporters: The bacitracin transport system (bcrABC) in B. licheniformis provides a valuable model - these transporters pump bacitracin out of cells to avoid self-intoxication and are significantly upregulated in bacitracin-producing strains . Similar expression patterns in crcB1 would suggest analogous functions.

  • Stress response profiling: Generate crcB1 knockout strains using CRISPR-Cpf1 and perform:

    • Growth curve analysis under various stressors (fluoride, antibiotics, pH, temperature)

    • Transcriptome profiling comparing wild-type and ΔcrcB1 strains under stress conditions

    • Proteomic analysis to identify compensatory changes in response to crcB1 deletion

  • Bacitracin production analysis: Measure bacitracin production in wild-type versus ΔcrcB1 strains using HPLC or bioassays. The role of transporters in antibiotic production is well-established in B. licheniformis, where the bcrABC system is significantly upregulated in response to bacitracin production .

  • Fluoride stress response: Based on homology to fluoride transporters, investigate whether crcB1 expression changes in response to fluoride exposure and if knockout strains show altered fluoride sensitivity.

Research on B. licheniformis has revealed extensive transcriptional changes with hundreds of genes differentially expressed between wild-type and regulatory mutants in different growth phases . Similar approaches can determine whether crcB1 participates in stress response networks or antibiotic production/resistance mechanisms.

  • How can protein-protein interactions of CrcB1 be effectively studied in B. licheniformis?

Studying protein-protein interactions (PPIs) of membrane proteins like CrcB1 requires specialized approaches that address the challenges of membrane protein biochemistry:

  • Bacterial two-hybrid systems: BACTH (Bacterial Adenylate Cyclase Two-Hybrid) is particularly suitable for membrane protein interactions. For CrcB1, fusion of adenylate cyclase fragments to either terminus permits detection of interactions without extraction from the membrane.

  • Co-immunoprecipitation with mass spectrometry: Using epitope-tagged CrcB1 (His-tag has proven effective with the B. cereus homolog ), perform co-IP followed by LC-MS/MS analysis to identify interacting partners. Critical considerations include:

    • Detergent selection for membrane solubilization (n-dodecyl β-D-maltoside often preserves interactions)

    • Cross-linking step before extraction to stabilize transient interactions

    • Stringent controls for non-specific binding

  • Proximity-dependent labeling: BioID or APEX2 fusions to CrcB1 allow in vivo labeling of neighboring proteins, overcoming challenges of traditional pull-down approaches for membrane proteins.

  • Fluorescence-based approaches: Förster Resonance Energy Transfer (FRET) or Bimolecular Fluorescence Complementation (BiFC) using fluorescent protein fusions can detect protein proximity in living B. licheniformis cells.

  • Validation through functional assays: Confirm biological relevance of identified interactions through co-knockout studies, comparing phenotypes of single and double mutants.

When interpreting results, researchers should cross-validate interactions using multiple methods, as membrane protein interactions can be sensitive to experimental conditions. Expression level normalization is essential to distinguish genuine interactions from artifacts of overexpression.

  • What are the most effective methods for analyzing CrcB1 ion transport activity?

To rigorously characterize CrcB1 ion transport activity, particularly for fluoride ions based on homology predictions, a comprehensive approach combining in vivo and in vitro methods is recommended:

  • Whole-cell fluoride uptake assays:

    • Using fluoride-selective electrodes to measure depletion from media

    • Fluorescent indicators (PBFI for indirect measurement of fluoride effects on potassium)

    • Comparing wild-type, ΔcrcB1, and complemented strains

    • Measuring kinetics across concentration ranges (0.1-100 mM fluoride)

  • Membrane vesicle transport assays:

    • Prepare inside-out membrane vesicles from B. licheniformis

    • Measure fluoride transport using fluoride-sensitive probes

    • Determine transport kinetics (Km, Vmax) and inhibitor profiles

  • Reconstitution into proteoliposomes:

    • Purify recombinant CrcB1 with appropriate tags (His-tag shown effective for homologs )

    • Reconstitute into defined liposomes with fluorescent indicators

    • Measure ion flux rates under controlled conditions

    • Test substrate specificity by challenging with other anions

  • Electrophysiology:

    • Patch-clamp analysis of CrcB1 reconstituted into giant liposomes or planar lipid bilayers

    • Characterize channel/transporter properties including:

      • Conductance

      • Ion selectivity

      • Voltage dependence

      • Gating characteristics

  • Computational approaches:

    • Molecular dynamics simulations of ion permeation through homology models

    • Docking studies with potential substrates and inhibitors

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.