Recombinant Bacillus licheniformis Thiol-disulfide oxidoreductase resA (resA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
resA; BLi02461; BL00661; Thiol-disulfide oxidoreductase ResA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)
Target Names
resA
Target Protein Sequence
MKKKRFYIRTGILLVLLAALGYTLYSAVFQNTESVAVGEKAPIFSLEDVDGNRLKLDELK GKGVFLNFWGTWCEPCKREFPYMANQYKVFKDKGVEIVAVNVGESNLAVRNFMKDHGVNF PVVLDKDRQVLNAYDVTPLPTTFLINPDGEIVKVVTGEMTERMIHDYMNMIKPEGSS
Uniprot No.

Target Background

Function

Thiol-disulfide oxidoreductase essential for disulfide bond reduction during c-type cytochrome synthesis. It may accept reducing equivalents from CcdA, facilitating the breakage of disulfide bonds in apocytochrome c, enabling subsequent covalent heme attachment.

Database Links
Protein Families
Thioredoxin family, ResA subfamily
Subcellular Location
Cell membrane; Single-pass type II membrane protein.

Q&A

What is ResA in Bacillus licheniformis and what is its function?

ResA (Respiratory System protein A) in B. licheniformis is a thiol-disulfide oxidoreductase that plays a crucial role in the maturation of c-type cytochromes. Similar to its homolog in B. subtilis, B. licheniformis ResA is a membrane-associated protein with its thioredoxin-like domain exposed to the outside of the cytoplasmic membrane . Its primary function is to reduce the disulfide bonds in the CXXCH motif of apocytochrome c to allow covalent attachment of heme. ResA works in conjunction with CcdA, another thiol-disulfide oxidoreductase, to maintain cysteines in their reduced state at the heme binding site of apocytochrome c . Without this reduction activity, cytochrome c synthesis cannot proceed properly, impacting respiratory metabolism.

How does ResA contribute to cytochrome c maturation in Bacillus licheniformis?

In B. licheniformis, as in B. subtilis, cytochrome c maturation requires the covalent attachment of heme to specific cysteine residues in the apocytochrome. This process occurs on the outside of the cytoplasmic membrane and requires reduced cysteine residues in the CXXCH motif of the apocytochrome . ResA contributes to this process by:

  • Reducing disulfide bonds in apocytochrome c after the polypeptide has been transferred across the cytoplasmic membrane

  • Counteracting the oxidizing activity of other TDORs like BdbD, which catalyzes disulfide bond formation

  • Maintaining the thiol groups in a reduced state until heme attachment can occur

Research with ResA-deficient B. subtilis strains demonstrates a complete lack of c-type cytochromes, confirming the essential role of ResA in this process . Cytochrome c synthesis can be restored through several mechanisms, including:

  • In trans expression of the resA gene

  • Deficiency in oxidizing TDORs like BdbD

  • Addition of external reductants like dithiothreitol to the growth medium

What are the structural characteristics of ResA in Bacillus licheniformis?

Based on similarities to B. subtilis ResA, B. licheniformis ResA is a membrane-associated protein consisting of approximately 181 residues with a single transmembrane segment and a C-terminal thioredoxin-like domain . Key structural features include:

Structural ElementCharacteristics
Transmembrane DomainN-terminal hydrophobic segment anchoring ResA to the membrane
Thioredoxin-like DomainLocated on the exterior side of the cytoplasmic membrane
Active SiteContains a CXXC motif with two redox-reactive cysteine residues
Redox PotentialApproximately -340 mV at pH 7 (based on B. subtilis ResA)
Folding PatternCharacteristic thioredoxin fold with central β-sheet surrounded by α-helices

The active site cysteines are positioned at the N-terminus of an α-helix, which lowers their pKa and enhances their reactivity for thiol-disulfide exchange reactions . The relatively negative redox potential makes ResA a strong reductant compared to other TDORs, consistent with its biological role in maintaining cysteines in their reduced state.

How does the expression of ResA affect the production of disulfide bond-containing proteins in Bacillus licheniformis?

The expression of ResA in B. licheniformis can significantly impact the production of disulfide bond-containing proteins, particularly those requiring specific disulfide configurations. When engineering B. licheniformis as a protein production host, the balance between oxidative and reductive TDORs is crucial:

  • Opposing activities: ResA's reductive activity counteracts the oxidizing action of BdbD/BdbC, creating a dynamic equilibrium that determines the net redox state of exported proteins .

  • Impact on heterologous proteins: For proteins requiring disulfide bonds, excessive ResA activity could hinder proper oxidative folding. Conversely, for proteins requiring reduced cysteines for function, ResA activity may be beneficial .

  • Strain engineering implications: Genome reduction strategies in Bacillus strains have demonstrated altered capacities for producing disulfide bond-containing proteins, possibly due to changes in the TDOR network including ResA .

A study in B. subtilis demonstrated that the delicate balance between oxidizing and reducing TDORs is critical—when this balance shifts too far toward oxidizing TDORs like BdbCD, the coexpression of additional oxidases can be counterproductive rather than beneficial . This suggests that ResA expression levels should be carefully optimized when engineering strains for protein production.

What expression systems are commonly used for recombinant production in Bacillus licheniformis?

For recombinant protein production in B. licheniformis, including TDORs like ResA, several expression systems have been developed:

Expression SystemCharacteristicsApplicationsReference
Plasmid-based Systems
pWH1520 (low copy)Tetracycline resistance, moderate expressionStable expression with lower metabolic burden
pLY-3 (high copy)Kanamycin resistance, high expressionMaximum protein yield when stability is less critical
Chromosomal Integration
Near origin of replicationEnhanced expression (1.67-fold increase in transcription)Stable, antibiotic-free expression
Promoter Systems
P(bacA)Strong constitutive promoter from bacitracin synthase operonContinuous high-level expression
Xylose-inducible promoterTight regulation, minimal leakinessControlled expression, reduced toxicity
Rhamnose-inducible P(rha)Glucose-independent inductionControlled expression not subject to catabolite repression

When selecting an expression system for ResA, considerations include:

  • Membrane protein expression often requires careful tuning to avoid toxicity

  • Integration near the origin of replication can provide up to 62.19% higher enzyme activity compared to wild-type expression

  • Inducible systems like the xylose-inducible promoter can significantly improve transformation efficiency (from <0.1 cfu/μg to 2.42 cfu/μg DNA)

What are the optimal conditions for expressing and purifying active recombinant ResA from Bacillus licheniformis?

Optimal expression and purification of recombinant ResA from B. licheniformis requires addressing several challenges related to its membrane association and redox sensitivity:

Expression Optimization:

  • Expression system selection:

    • Chromosomal integration near origin of replication shows 1.67-fold increase in transcription and 62.19% improvement in enzyme activity compared to wild-type expression

    • For controlled expression, the xylose-inducible promoter provides strict regulation with 0.5% xylose as an effective inducer concentration

  • Host strain considerations:

    • Consider using strains with reduced protease activity

    • Deleting the genes encoding extracellular mucopolysaccharide (eps cluster) reduces viscosity during fermentation

    • Deletion of lchAC genes related to foaming can improve fermentation properties

  • Culture conditions:

    • Growth temperature: 30-37°C is typically optimal

    • Media: Rich media for high biomass, minimal media for reduced proteolytic activity

    • Induction timing: Mid-log phase (OD600 ~0.6-0.8)

Purification Strategy:

Purification StepCritical ParametersNotes
Membrane ExtractionGentle cell disruption, buffer with 20-25% sucrosePreserves membrane integrity and membrane protein associations
Membrane SolubilizationMild detergents (DDM, LDAO), 1-2% concentrationDetergent selection crucial for maintaining activity
Buffer CompositionInclude reducing agents (1-5 mM DTT or TCEP)Prevents oxidation of active site cysteines
ChromatographyAffinity tag (His, Strep) followed by size exclusionMinimize exposure to oxidizing conditions
Activity PreservationStore with glycerol (10-20%) at -80°CMonitor redox state and activity throughout process

For membrane proteins like ResA, maintaining the native membrane environment or using suitable membrane mimetics is critical for preserving structure and function throughout purification.

How can the redox activity of ResA be measured in vitro and in vivo?

Assessing the redox activity of ResA requires complementary approaches to understand its biochemical properties and physiological function:

In vitro Methods:

  • Redox potential determination:

    • Protein film voltammetry using gold electrodes

    • Equilibration with redox buffers of known potential followed by AMS alkylation to trap the reduced state

    • Differential alkylation with iodoacetamide and iodoacetic acid followed by mass spectrometry

  • Enzymatic activity assays:

    • Insulin reduction assay: Monitor the precipitation of reduced insulin chains at 650 nm

    • DTNB (Ellman's reagent) reduction: Quantify free thiols by measuring TNB formation at 412 nm

    • Reduction of oxidized RNase A with monitoring of recovered RNase activity

  • Protein-substrate interaction analysis:

    • Surface plasmon resonance to measure binding kinetics with apocytochrome c

    • Isothermal titration calorimetry to quantify thermodynamic parameters of interactions

    • Trapping and identification of mixed disulfides using mutated active site variants

In vivo Methods:

  • Genetic complementation:

    • Restoration of cytochrome c synthesis in ResA-deficient strains

    • Growth rescue under conditions requiring functional cytochrome c

    • Cross-complementation with ResA homologs from different species

  • Redox state analysis:

    • In vivo thiol trapping with 4-acetamido-4'-maleimidylstilbene-2,2'-disulfonic acid (AMS)

    • OxICAT labeling for quantitative redox proteomics

    • Redox Western blotting to visualize protein redox states

  • Functional assessments:

    • Spectroscopic quantification of c-type cytochromes (550-560 nm absorbance)

    • Respiratory capacity measurements (oxygen consumption)

    • Electron transfer chain activity assays

Similar methodology has been successfully applied to study other TDORs in Bacillus strains, revealing how the balance between oxidative and reductive pathways affects protein production .

How does mutation of the active site cysteines affect ResA function in Bacillus licheniformis?

Mutation of the active site cysteines in ResA dramatically affects its function, with distinct consequences depending on the specific mutations:

Mutation TypeStructural ImpactFunctional ConsequenceResearch Application
C→S (Cys to Ser)Preserves hydroxyl group, similar sizeEliminates redox activity but retains substrate bindingTrapping mixed disulfide intermediates
C→A (Cys to Ala)Removes reactive thiol groupAbolishes both redox activity and substrate interactionsNegative control for activity studies
XX in CXXCAlters active site microenvironmentChanges redox potential and reaction kineticsFine-tuning redox properties
Spacing between cysteinesAffects dithiol geometryModifies substrate specificityEngineering substrate selectivity

The physiological consequences of these mutations in B. licheniformis would include:

  • Impaired cytochrome c maturation:

    • Studies in B. subtilis show that ResA deficiency leads to a complete lack of c-type cytochromes

    • This would result in respiratory defects, particularly under conditions requiring cytochrome c function

  • Redox imbalance effects:

    • Altered interactions with other TDORs in the network

    • Potential compensatory upregulation of alternative reduction pathways

    • Changed sensitivity to oxidative stress

  • Dominant negative effects:

    • Catalytically inactive ResA variants that can still bind substrates might trap them in nonproductive complexes

    • This could be more detrimental than a complete deletion of ResA

Research in related Bacillus systems has shown that the delicate balance between oxidizing and reducing TDORs is critical for proper function, and disruption of this balance affects the production of disulfide bond-containing proteins .

What is the interaction network of ResA with other thiol-disulfide oxidoreductases in Bacillus licheniformis?

ResA functions within an interconnected network of thiol-disulfide oxidoreductases that maintain redox homeostasis in B. licheniformis:

Key Interacting TDORs and Their Functions:

This network functions through coordinated electron transfer pathways:

  • Reductive pathway: NADPH → Thioredoxin reductase → Thioredoxin → CcdA → ResA → Substrate proteins

  • Oxidative pathway: Quinones → BdbC → BdbD → Substrate proteins

Research in B. subtilis has demonstrated that depleting cytoplasmic reductive TDORs like TrxA results in relatively higher levels of oxidized BdbD, affecting the entire redox balance . This interconnectedness means that modifying one component (like ResA) has system-wide effects on protein folding and maturation.

The thiol-disulfide oxidoreductase network responds dynamically to environmental conditions:

  • Oxidative stress triggers adaptive responses involving multiple TDORs

  • Respiratory metabolism influences quinone status and electron flow through the system

  • Growth phase and nutrient availability affect expression levels of different TDORs

Understanding these interactions is crucial for engineering B. licheniformis strains with enhanced capabilities for producing disulfide bond-containing proteins.

How can genome editing approaches be used to modify resA in Bacillus licheniformis?

Several genome editing technologies have been successfully applied to B. licheniformis and can be used to modify the resA gene:

CRISPR-Cas9 System:

A conditional CRISPR-Cas9 system with xylose-inducible promoter has been developed specifically for B. licheniformis, offering significant advantages:

  • Without xylose, Cas9 expression is repressed, improving transformation efficiency from <0.1 cfu/μg to 2.42 cfu/μg DNA

  • After transformation, genome editing can be triggered by adding 0.5% xylose

  • This approach minimizes growth retardation compared to constitutive Cas9 expression systems

Implementation strategy for resA modification:

  • Design sgRNA targeting resA

  • Construct repair template with desired modifications

  • Transform into B. licheniformis

  • Maintain without xylose during transformation

  • Induce with xylose to trigger editing

  • Screen for successful editing

Traditional Homologous Recombination:

For markerless genome editing without CRISPR, a two-step process can be used:

  • Integration phase:

    • Create a deletion plasmid containing homologous regions flanking resA

    • Transform into B. licheniformis

    • Select transformants using antibiotic markers

    • Verify single-crossover integration by PCR

  • Excision phase:

    • Culture without selection to allow second recombination

    • Screen for plasmid loss and desired modification

    • Verify by PCR and sequencing

Integration site selection:
Research has shown that chromosomal integration near the origin of replication enhances expression levels (1.67-fold increase in transcription and 62.19% improvement in enzyme activity compared to wild-type expression) . This principle can be applied when reintegrating modified resA variants.

Specific resA modifications to consider:

  • Active site mutations (CXXC motif) to alter redox properties

  • Fusion with reporter tags for localization studies

  • Promoter engineering for controlled expression

  • Domain swapping with other TDORs for modified functionality

What methodologies are effective for studying the membrane association of ResA in Bacillus licheniformis?

Investigation of ResA's membrane association requires complementary approaches to understand its topology, dynamics, and functional relationships:

Membrane Fractionation and Localization:

  • Subcellular fractionation:

    • Differential centrifugation to separate cytoplasmic and membrane fractions

    • Sucrose density gradient centrifugation for refined membrane separation

    • Western blotting using anti-ResA antibodies to track localization

  • Topology determination:

    • Protease accessibility assays: Treatment of intact cells, protoplasts, and membrane vesicles with proteases

    • Site-directed labeling: Introduction of cysteine residues at various positions followed by labeling with membrane-impermeable reagents

    • Fusion reporter systems: PhoA or GFP fusions to determine extracellular vs. cytoplasmic orientation

Protein-Membrane Interaction Analysis:

  • Detergent solubilization profiles:

    • Systematic testing of detergents (ionic, non-ionic, zwitterionic)

    • Quantification of extraction efficiency under various conditions

    • Assessment of activity retention after solubilization

  • Lipid interaction studies:

    • Liposome binding assays with purified ResA

    • Fluorescence anisotropy to measure protein-lipid interactions

    • Model membrane systems with varied lipid composition

Structural and Dynamic Approaches:

  • Biophysical methods:

    • Site-directed spin labeling coupled with electron paramagnetic resonance (EPR)

    • Hydrogen/deuterium exchange mass spectrometry to identify membrane-protected regions

    • Fluorescence spectroscopy to monitor conformational changes upon membrane binding

  • Computational approaches:

    • Molecular dynamics simulations of ResA in membrane environments

    • Hydrophobicity analysis and transmembrane domain prediction

    • Homology modeling based on related thioredoxin-like proteins

Similar methodologies have been successfully applied to study membrane-associated TDORs in other Bacillus species, revealing their orientation and functional domains .

How can ResA be engineered for enhanced activity or altered specificity?

Engineering ResA for improved or modified properties requires targeting specific structural elements that determine its function:

Active Site Engineering:

Engineering ApproachMethodExpected OutcomeApplications
CXXC motif modificationSite-directed mutagenesis of XX residuesAltered redox potentialFine-tuning specificity for target proteins
Loop modificationsInsertion/deletion of residues around active siteChanged substrate accessibilityAccommodating larger or specific substrates
Secondary coordination sphereMutation of residues near active siteModified reaction kineticsEnhancing catalytic efficiency

Domain and Structure Engineering:

  • Chimeric constructs:

    • Fusion of ResA with substrate-binding domains from other proteins

    • Creation of hybrid TDORs combining domains from different oxidoreductases

    • Introduction of dimerization domains for enhanced stability

  • Stability engineering:

    • Introduction of disulfide bonds for structural stabilization

    • Surface redesign to enhance solubility

    • Core packing optimization to increase thermostability

Directed Evolution Approaches:

  • Library creation methods:

    • Error-prone PCR for random mutagenesis throughout the sequence

    • DNA shuffling with related TDORs for recombination of beneficial mutations

    • Focused randomization of specific regions (e.g., active site loops)

  • Selection strategies:

    • Complementation of ResA-deficient strains under selective pressure

    • Reporter systems linked to target protein folding

    • Phage display for selecting variants with desired binding properties

Computational Design:

  • In silico prediction:

    • Rosetta-based computational design of the active site environment

    • Molecular dynamics simulations to predict mutation effects

    • Quantum mechanical calculations for redox potential prediction

Research on other TDORs in Bacillus has shown that engineering approaches can significantly enhance production of disulfide bond-containing proteins. For example, co-expression of staphylococcal DsbA in B. subtilis increased production of active E. coli PhoA by 1.5-2.0 fold . Similar principles could be applied to ResA engineering for specialized applications.

What is the role of ResA in Bacillus licheniformis adaptation to environmental stresses?

ResA contributes to B. licheniformis stress adaptation through both its specific function in cytochrome c maturation and broader roles in redox homeostasis:

Oxidative Stress Responses:

  • Direct protective effects:

    • Maintenance of reduced thiols in specific extracytoplasmic proteins during oxidative stress

    • Counteraction of oxidative damage to essential respiratory components

    • Support of cytochrome c maturation, which is critical for respiratory adaptation

  • Integration with stress response systems:

    • Coordination with other TDORs during oxidative challenge

    • Potential regulation by global stress response regulators

    • Contribution to the repair of oxidatively damaged proteins

B. licheniformis activates various stress response mechanisms when exposed to environmental challenges. For example, when subjected to 2-phenylethanol stress, B. licheniformis DW2 shows activation of antioxidant systems, global stress responses, and repair systems for proteins . ResA likely participates in these adaptive responses by maintaining the function of respiratory components.

Metabolic Adaptations:

Under stress conditions, B. licheniformis adjusts its metabolism, including upregulation of the tricarboxylic acid cycle and NADPH synthesis pathways . These adaptive responses affect cellular redox balance, which in turn influences ResA function and its interaction with other TDORs. The interconnectedness of ResA with cellular redox systems allows it to respond dynamically to changing environmental conditions.

Experimental Approaches to Study ResA's Role in Stress Adaptation:

  • Comparative stress resistance of wild-type vs. resA mutant strains

  • Transcriptomic and proteomic profiling under various stress conditions

  • Redox proteomics to identify ResA-dependent protein modifications during stress

  • Analysis of respiratory capacity and efficiency under stress conditions

Understanding how ResA contributes to stress adaptation could inform strategies for improving B. licheniformis as a production host in challenging industrial conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.