Recombinant Bacillus licheniformis Undecaprenyl-diphosphatase 1 (uppP1)

Shipped with Ice Packs
In Stock

Description

Functional Role in Cell Wall Synthesis and Stress Response

Cell Wall Homeostasis
Undecaprenyl-diphosphatase 1 (uppP1) regulates the lipid II cycle, a precursor for peptidoglycan synthesis. By converting UP to UP, it ensures continuous lipid II availability for cell wall assembly. In Bacillus subtilis, homologs like BcrC and UppP are pivotal in maintaining cell envelope integrity under stress .

Bacitracin Resistance Mechanism
Bacitracin inhibits cell wall synthesis by binding UP, forming a UP-bacitracin complex that depletes lipid II. UPP phosphatases like uppP1 counteract this by hydrolyzing UP, competing with bacitracin and restoring lipid II production. In B. subtilis, BcrC deletion strains show elevated stress responses (e.g., P liaI promoter activity) and reduced bacitracin resistance, underscoring the enzyme’s critical role .

Cell Envelope Stress Response
In B. subtilis, UPP phosphatases (BcrC/UppP) modulate the LiaFSR system, which detects cell envelope stress. While direct evidence for B. licheniformis uppP1 is limited, structural homology suggests analogous functions in stress adaptation .

Recombinant Production and Applications

Production Parameters

  • Expression Region: 1–270 amino acids

  • Commercial Availability: Sold as lyophilized powder (e.g., 50 µg vials) for research use

  • Detection Methods: Used in ELISA kits for protein quantification

Research Applications

ApplicationDetails
Antibiotic Resistance StudiesInvestigating bacitracin resistance mechanisms and UP regeneration pathways
Cell Wall EngineeringModulating lipid II synthesis for novel antimicrobial strategies
Genetic Tool DevelopmentEnhancing B. licheniformis as a biomanufacturing platform

Comparative Analysis with Homologs

Bacillus licheniformis vs. Bacillus subtilis UPP Phosphatases

FeatureB. licheniformis uppP1B. subtilis BcrC/UppP
Primary FunctionUP hydrolysis, bacitracin resistanceUP hydrolysis, stress response regulation
RegulationNot explicitly studiedControlled by σ M and σ X (ECF sigma factors)
Stress ResponseInferred from homologyDirectly linked to LiaFSR system activation
Industrial RelevancePotential in probiotic/bioproduction systems Established in biofuel and antibiotic research

Challenges and Future Directions

Knowledge Gaps

  • Direct evidence of B. licheniformis uppP1’s role in bacitracin resistance remains limited to homology-based inferences.

  • Mechanistic studies on promoter regulation (e.g., P liaI equivalents) are needed.

Future Research

  • Biotechnological Engineering: Leveraging uppP1 to enhance B. licheniformis strains for biofuel production or antimicrobial synthesis .

  • Therapeutic Applications: Exploring uppP1 inhibitors as novel antibiotics targeting UP-dependent pathogens.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order remarks. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All protein shipments are standardly sent with blue ice packs. If dry ice packaging is required, please inform us in advance as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For working aliquots, storage at 4°C for up to one week is suitable.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development according to your specifications.
Synonyms
uppP1; BLi01213; BL03255; Undecaprenyl-diphosphatase 1; Bacitracin resistance protein 1; Undecaprenyl pyrophosphate phosphatase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)
Target Names
uppP1
Target Protein Sequence
MDFLVLIKYILLGLLQGFTEPIPVSSSGHLVLAQHFLGLNIEGFSFELLMNAGSLIAVLL VYKNDIFRLAVNGLSYVTTKNEKGKADFRFIIYLIIATIPAGVIGVLFDDEISAFFKDGV RITAVTLLITGLALFLIRNLRGRKSDGEIRLRDAVIIGFSQMVALVPGISRSGATIVPAM ALGLKSETALRFSFLLYIPVSLGGTILSITDIFHDPRLGELFLPYLFAFIASVIATYFSL RWFMNIMAKGNLVYFSIYCFVIGIAVLIFA
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase 1 (uppP1) and what is its role in Bacillus licheniformis?

Undecaprenyl-diphosphatase 1 (uppP1) is an essential enzyme involved in bacterial cell wall biosynthesis in Bacillus licheniformis. It catalyzes the dephosphorylation of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP), a crucial carrier molecule in the lipid II cycle. This cycle is responsible for transporting cell wall building blocks assembled in the cytoplasm to the outside of the cell for incorporation into the existing cell wall .

In B. licheniformis, as in the closely related B. subtilis, UPP phosphatases like uppP1 play a vital role in maintaining cell wall integrity and are therefore essential for bacterial survival. These enzymes are part of a recycling mechanism where the carrier molecule UP is reused multiple times, making the process energetically efficient for the bacterium .

How does the lipid II cycle function, and where does uppP1 fit within this pathway?

The lipid II cycle is a complex process that facilitates cell wall synthesis in bacteria. The cycle begins with undecaprenyl phosphate (UP), which serves as a carrier molecule. UP is loaded with cell wall precursors to form lipid II. After the precursor is incorporated into the growing cell wall, undecaprenyl pyrophosphate (UPP) is released and must be recycled back to UP to continue the cycle .

UppP1 catalyzes this critical recycling step by dephosphorylating UPP to UP. Without this dephosphorylation, the lipid II cycle would halt, preventing cell wall synthesis and ultimately leading to bacterial cell death. The figure from the research literature illustrates this cycle, showing that UPP phosphatases (including uppP1) provide the essential link between the release of UPP and its recycling back to UP .

How do UPP phosphatases in Bacillus species relate to antibiotic resistance?

UPP phosphatases in Bacillus species play a significant role in antibiotic resistance, particularly against antibiotics that target the cell wall synthesis pathway. The antibiotic bacitracin specifically binds to UPP, forming a UPP-bacitracin complex that prevents dephosphorylation by UPP phosphatases. This inhibits the recycling of the carrier molecule and ultimately arrests the lipid II cycle .

Studies with B. subtilis show that the UPP phosphatase BcrC provides a layer of resistance against bacitracin by competing with the antibiotic for the same target molecule, UPP. When BcrC is deleted, the minimal inhibitory concentration (MIC) for bacitracin decreases significantly from >256 μg/ml to approximately 120 μg/ml. This demonstrates that UPP phosphatases contribute to intrinsic antibiotic resistance mechanisms in Bacillus species .

What expression systems are most effective for producing recombinant B. licheniformis uppP1?

Based on experimental approaches used with related UPP phosphatases, effective expression systems for recombinant B. licheniformis uppP1 typically involve:

  • E. coli expression systems: BL21(DE3) or derivatives are commonly used with vectors like pET series that place the gene under control of a T7 promoter.

  • B. subtilis expression systems: For homologous expression, vectors with xylose-inducible promoters (PxylA) have been successfully employed for UPP phosphatases. Research with B. subtilis shows that complementation using an ectopically integrated PxylA-uppP construct was successful in restoring normal phenotypes in UPP phosphatase mutants .

  • Purification approach: Including a His-tag at either the N or C-terminus facilitates purification while maintaining enzymatic activity, provided the tag doesn't interfere with the membrane association domains of the protein.

When working with uppP1, it's crucial to consider its nature as a membrane protein, which may require the inclusion of detergents during purification and handling.

What methods can be used to assess the enzymatic activity of recombinant uppP1?

Several methodological approaches can be employed to assess the enzymatic activity of recombinant uppP1:

  • Phosphate release assays: Measuring inorganic phosphate released during the dephosphorylation of UPP using colorimetric methods like malachite green assay.

  • Radiolabeled substrate assays: Using [32P]-labeled UPP as a substrate and measuring the release of radiolabeled phosphate.

  • HPLC analysis: Separation and quantification of the substrate (UPP) and product (UP) to directly measure conversion rates.

  • In vivo complementation assays: Testing the ability of recombinant uppP1 to complement UPP phosphatase deficiencies in model organisms. In B. subtilis, complementation of UPP phosphatase mutants with ectopically expressed phosphatases restored normal growth, cell morphology, and resistance to bacitracin .

  • Promoter-reporter assays: Using reporter systems like luciferase (lux) fusions to monitor the cellular response to UPP phosphatase activity, similar to the PbcrC-lux and PyubA-lux systems used in B. subtilis research .

How can the membrane association of uppP1 be managed during biochemical studies?

Managing the membrane association of uppP1 during biochemical studies requires specific approaches:

  • Detergent selection: Mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin preserve enzyme activity while solubilizing the protein from membranes.

  • Nanodiscs or liposomes: Reconstituting uppP1 into nanodiscs or liposomes can provide a native-like membrane environment for functional studies.

  • Truncation constructs: Generating truncated versions of uppP1 that retain the catalytic domain but remove hydrophobic membrane-spanning regions may improve solubility.

  • Co-expression with chaperones: Expression alongside bacterial chaperones can improve the folding and stability of membrane proteins like uppP1.

  • Buffer optimization: Including glycerol (10-20%) and maintaining physiological ionic strength helps stabilize membrane proteins during purification and storage.

When measuring activity, it's essential to consider that membrane proteins often perform optimally in conditions that mimic their native membrane environment, which may require the inclusion of specific lipids in the assay system.

How do deletions or mutations of uppP1 affect B. licheniformis phenotypes?

Based on studies of UPP phosphatases in the related B. subtilis, deletions or mutations of uppP1 in B. licheniformis likely produce several phenotypic effects:

  • Growth defects: While deletion of a single UPP phosphatase may not be lethal due to redundancy, it likely leads to reduced growth rates, particularly during exponential phase. In B. subtilis, deletion of uppP resulted in a slight but measurable reduction in growth rate .

  • Sporulation defects: UppP plays a crucial role in sporulation in B. subtilis, and by extension, uppP1 likely has a similar function in B. licheniformis. Reduced levels of UppP in B. subtilis significantly impaired sporulation, suggesting that uppP1 may be particularly important during this developmental process .

  • Morphological abnormalities: Limitation of UPP phosphatase activity leads to severe morphological defects in B. subtilis, including filamentous growth and abnormal cell division. Similar phenotypes would be expected in B. licheniformis with uppP1 mutations .

  • Antibiotic sensitivity: Mutants with reduced uppP1 activity would likely show increased sensitivity to cell wall-targeting antibiotics, particularly bacitracin. In B. subtilis, deletion of UPP phosphatases reduced the minimal inhibitory concentration (MIC) for bacitracin .

What is the relationship between uppP1 and other UPP phosphatases in B. licheniformis?

Based on the understanding of UPP phosphatases in B. subtilis, B. licheniformis likely possesses multiple UPP phosphatases with overlapping but distinct functions:

  • Genetic redundancy: B. licheniformis likely carries homologs of the three UPP phosphatases found in B. subtilis (BcrC, UppP, and YodM). The uppP1 gene likely forms a synthetic lethal pair with another UPP phosphatase (possibly a BcrC homolog), meaning that while either gene can be deleted individually, simultaneous deletion of both would be lethal .

  • Differential regulation: Different UPP phosphatases are likely regulated by distinct stress response mechanisms. In B. subtilis, bcrC is regulated by the ECF sigma factors σM and σX and is upregulated in response to cell envelope stress, while uppP expression remains relatively constant .

  • Functional specialization: UppP/uppP1 appears to be more important for developmental processes like sporulation, while BcrC plays a more significant role during vegetative growth and in response to cell envelope stress .

  • Contribution to UP pool: Together with de novo synthesis pathways and undecaprenol phosphorylation by kinases like DgkA, the UPP phosphatases contribute to maintaining the cellular UP pool, which is essential for cell wall synthesis .

How does the cell envelope stress response relate to uppP1 function?

The cell envelope stress response (CESR) is intricately connected to UPP phosphatase function, including uppP1:

What are the main challenges in working with recombinant uppP1 and how can they be overcome?

Working with recombinant uppP1 presents several significant challenges:

  • Membrane protein expression: As a membrane-associated protein, uppP1 can be difficult to express in functional form.

    • Solution: Use specialized expression systems designed for membrane proteins, such as C41/C43 E. coli strains or Bacillus expression systems. Lower expression temperatures (16-20°C) and mild induction conditions can improve proper folding.

  • Protein solubility: Maintaining the solubility of uppP1 during purification is challenging.

    • Solution: Employ appropriate detergents or membrane mimetics throughout the purification process. Screening multiple detergents (DDM, LMNG, CHAPS) can identify optimal conditions for uppP1 stability.

  • Activity measurement: UPP phosphatase activity can be difficult to measure reliably.

    • Solution: Develop a combination of approaches, including both in vitro biochemical assays and in vivo complementation tests. Radiolabeled substrate approaches often provide the highest sensitivity for phosphatase activity detection.

  • Substrate availability: Natural substrates like UPP can be difficult to obtain in pure form.

    • Solution: Consider using synthetic substrate analogs that maintain the essential features of UPP but are more readily available or stable. Alternatively, enzymatically generate UPP using UppS (UPP synthase) as part of an assay system.

How can researchers interpret conflicting results in uppP1 studies?

When facing conflicting results in uppP1 studies, researchers should consider several potential explanations and resolution approaches:

  • Strain-specific differences: Variations in results may stem from differences in B. licheniformis strains.

    • Resolution: Always clearly document the exact strain used, verify its identity through sequencing, and directly compare multiple strains under identical conditions when possible.

  • Expression system artifacts: Different expression systems can yield proteins with varying levels of activity.

    • Resolution: Compare the activity of uppP1 expressed in different systems and validate findings with complementation assays in UPP phosphatase-deficient strains.

  • Assay condition variations: UPP phosphatase activity is sensitive to buffer conditions, detergents, and substrate presentation.

    • Resolution: Systematically test the effects of pH, ionic strength, detergent type/concentration, and substrate preparation method. Develop standardized assay conditions to facilitate cross-laboratory comparisons.

  • Functional redundancy: The presence of multiple UPP phosphatases can mask phenotypes in single gene studies.

    • Resolution: Consider creating multiple deletion strains where combinations of UPP phosphatases are removed, similar to the approach used in B. subtilis studies .

  • Contradictory literature: Earlier studies reported successful construction of double deletion mutants of UPP phosphatases, while more recent studies found such combinations to be synthetic lethal.

    • Resolution: Examine the methodologies carefully. In B. subtilis, earlier studies using single homologous recombination apparently left gene fragments with residual activity, while more recent studies using complete allelic replacement revealed the synthetic lethality .

What future research directions should be explored for B. licheniformis uppP1?

Several promising research directions for B. licheniformis uppP1 warrant further investigation:

  • Structural biology: Determine the three-dimensional structure of uppP1 to understand its catalytic mechanism and membrane interaction. This could leverage approaches similar to those used for E. coli UPP phosphatases like PgpB .

  • Pathway integration: Explore the relative contributions of UPP recycling versus de novo synthesis to the UP pool. This includes studying the interactions between uppP1, UppS (UPP synthase), and DgkA (undecaprenol kinase) .

  • Lipid II cycle stoichiometry: Investigate the quantitative aspects of the lipid II cycle, including the number of UP carrier molecules per cell and their turnover rates during different growth phases .

  • Differential regulation: While research in B. subtilis showed that bcrC expression changes in response to cell envelope stress while uppP expression remains relatively constant , the regulatory mechanisms controlling uppP1 expression in B. licheniformis remain to be fully characterized.

  • Biotechnological applications: Explore the potential for engineered uppP1 variants with altered specificity or activity for biotechnological applications, particularly in antibiotic development or bacterial cell wall engineering.

  • Species-specific differences: Investigate how uppP1 function in B. licheniformis differs from its homologs in other Bacillus species, especially considering the industrial importance of B. licheniformis .

What is the optimal approach for generating uppP1 deletion or depletion strains in B. licheniformis?

Creating effective uppP1 deletion or depletion strains requires careful methodological considerations:

  • Complete allelic replacement: Use double homologous recombination to completely replace the uppP1 gene with a selectable marker. This approach is critical, as studies in B. subtilis revealed that single homologous recombination methods sometimes leave functional gene fragments that can confound results .

  • Inducible depletion systems: For essential genes or synthetic lethal pairs, implement inducible expression systems:

    • The xylose-inducible system (PxylA) has been successfully used in B. subtilis for UPP phosphatase studies .

    • Place a complementing copy of uppP1 under an inducible promoter before attempting to delete the native gene.

  • CRISPR-dCas9 knockdowns: Consider using CRISPR interference with deactivated Cas9 (dCas9) to achieve tunable gene repression without complete deletion, as demonstrated for UPP phosphatases in B. subtilis .

  • Verification methods: Confirm deletions using multiple approaches:

    • PCR verification of the deletion junction

    • RT-PCR to confirm absence of transcript

    • Western blotting if antibodies are available

    • Phenotypic complementation tests

  • Control for polar effects: Ensure that gene deletions don't affect the expression of downstream genes in the same operon. Although uppP appears to be monocistronic in B. subtilis , verification of the genomic context in B. licheniformis is important.

What reporter systems can effectively monitor uppP1 activity and regulation?

Several reporter systems can be employed to monitor uppP1 activity and regulation:

  • Promoter-luciferase fusions: Creating a PuppP1-lux fusion allows real-time monitoring of uppP1 expression under different conditions. This approach was successfully used to study UPP phosphatase gene expression in B. subtilis .

  • CESR reporter systems: Since UPP phosphatase limitation triggers cell envelope stress responses, reporters for these pathways can indirectly monitor UPP phosphatase activity:

    • PliaI-lux for the LiaFSR system response

    • PbcrC-lux for the σM and σX responses

  • Fluorescent protein fusions: C-terminal fusions of fluorescent proteins to uppP1 can monitor protein localization and expression levels, provided the fusion doesn't disrupt function.

  • Growth-based reporters: Engineer strains where growth is dependent on uppP1 activity, such as UPP phosphatase-depleted strains complemented with uppP1 variants.

  • Antibiotic sensitivity testing: Bacitracin sensitivity assays provide a phenotypic readout related to UPP phosphatase activity. Quantitative methods like E-test strips can measure the MIC of bacitracin as an indirect measure of UPP phosphatase function .

How can uppP1 activity be differentiated from other UPP phosphatases in B. licheniformis?

Differentiating uppP1 activity from other UPP phosphatases requires specialized approaches:

  • Genetic approaches:

    • Generate single and combinatorial deletion mutants of all UPP phosphatases.

    • Create strains with only one functional UPP phosphatase by deleting all others.

    • Use complementation studies with specific UPP phosphatases to restore function in multiple deletion backgrounds .

  • Biochemical approaches:

    • Develop inhibitors with specificity for different UPP phosphatases.

    • Characterize the kinetic parameters (Km, Vmax) for each purified UPP phosphatase to identify differences in substrate specificity or catalytic efficiency.

    • Examine differences in pH optima, metal ion requirements, or detergent sensitivity between the different enzymes.

  • Expression profiling:

    • Monitor the expression patterns of different UPP phosphatases under various conditions using qRT-PCR or promoter-reporter fusions.

    • In B. subtilis, bcrC expression increases under cell envelope stress conditions, while uppP expression remains relatively constant .

  • Phenotypic analysis:

    • Assess the contribution of each UPP phosphatase to specific phenotypes. For example, in B. subtilis, UppP plays a more important role in sporulation, while BcrC is more crucial during vegetative growth and stress response .

How does B. licheniformis uppP1 compare to homologous proteins in other bacterial species?

A comparative analysis of B. licheniformis uppP1 with homologs in other species reveals important similarities and differences:

What is the significance of uppP1 in the industrial applications of B. licheniformis?

B. licheniformis is widely used in industrial fermentation for enzyme production , and understanding uppP1 function could have significant implications:

  • Strain engineering: Knowledge of uppP1 function could inform strain improvement strategies:

    • Modulating uppP1 expression might enhance cell wall integrity during high-density fermentation

    • Engineering UPP phosphatase activity could potentially improve growth rates or product yields

    • Understanding cell envelope stress responses related to UPP phosphatase function could help develop more robust industrial strains

  • Bioprocess optimization: UPP phosphatases affect sensitivity to environmental stressors like antibiotics and could influence:

    • Culture robustness in non-sterile or contamination-prone processes

    • Tolerance to shear stress in bioreactors

    • Performance in continuous fermentation processes

  • Enzyme production: B. licheniformis is used for production of enzymes like proteases and amylases . Cell wall integrity, influenced by uppP1 function, affects:

    • Protein secretion efficiency

    • Cell lysis during production

    • Downstream processing requirements

  • Safety considerations: Understanding the role of uppP1 in B. licheniformis pathogenicity is important since:

    • B. licheniformis has been associated with infections in immunocompromised individuals

    • UPP phosphatases contribute to intrinsic antibiotic resistance mechanisms

    • Ensuring the safety of industrial strains requires comprehensive knowledge of factors affecting pathogenicity

How can uppP1 be leveraged for developing new antimicrobial strategies?

UPP phosphatases like uppP1 represent promising targets for antimicrobial development:

  • Target validation: The essential nature of UPP phosphatases in bacteria and their absence in humans makes them attractive antibiotic targets. The synthetic lethality observed between uppP and bcrC in B. subtilis suggests that inhibiting multiple UPP phosphatases simultaneously could be an effective strategy.

  • Synergistic approaches: Combining UPP phosphatase inhibitors with existing antibiotics like bacitracin could produce synergistic effects. Since bacitracin binds to UPP and prevents its dephosphorylation by UPP phosphatases , compounds that inhibit the remaining phosphatase activity could further disrupt the lipid II cycle.

  • Resistance considerations: Understanding the redundancy and regulation of UPP phosphatases helps predict and counter potential resistance mechanisms. For example, B. subtilis upregulates bcrC expression under cell envelope stress conditions , suggesting that effective therapies might need to target multiple phosphatases simultaneously.

  • Screening approaches: Developing high-throughput screens for UPP phosphatase inhibitors could leverage:

    • Cell-based assays using strains with reduced UPP phosphatase activity

    • Reporter systems that monitor cell envelope stress responses

    • In vitro enzymatic assays with purified recombinant uppP1

  • Structure-based drug design: Detailed structural information about uppP1 could facilitate rational design of inhibitors targeting catalytic sites or membrane-binding regions.

How can recombinant uppP1 be used as a research tool in cell wall biosynthesis studies?

Recombinant uppP1 can serve as a valuable research tool in cell wall biosynthesis studies:

  • In vitro reconstruction of the lipid II cycle: Purified uppP1 can be used alongside other enzymes of the lipid II cycle to reconstruct the pathway in vitro, enabling detailed mechanistic studies of cell wall assembly.

  • Substrate generation: Recombinant uppP1 can generate UP from UPP for use in other enzymatic assays focused on downstream steps in peptidoglycan synthesis.

  • Inhibitor screening: Purified uppP1 provides a system for screening and characterizing inhibitors of UPP phosphatases, which could help develop new antibiotics targeting cell wall synthesis.

  • Structural biology: Purified recombinant uppP1 can be used for crystallization trials or cryo-EM studies to determine its three-dimensional structure, providing insights into the catalytic mechanism.

  • Protein-protein interaction studies: Tagged versions of uppP1 can be used to identify interaction partners in the cell wall biosynthesis machinery, potentially revealing new regulatory mechanisms or multiprotein complexes involved in cell wall assembly.

  • Synthetic biology applications: Recombinant uppP1 could be employed in synthetic biology approaches to engineer bacterial cell walls with novel properties or to develop cell-free systems for producing complex carbohydrates.

What are the key considerations for designing experiments to study uppP1 regulation?

When designing experiments to study uppP1 regulation, researchers should consider:

  • Promoter architecture analysis:

    • Identify potential transcription factor binding sites in the uppP1 promoter region

    • Compare with known regulatory elements in B. subtilis uppP, which may provide clues about conservation of regulatory mechanisms

    • Create targeted mutations in potential regulatory elements to test their functional significance

  • Expression profiling:

    • Use quantitative RT-PCR or promoter-reporter fusions (PuppP1-lux) to monitor expression under various conditions

    • Test expression during different growth phases, as UPP phosphatase requirements may change during the bacterial life cycle

    • Examine expression under cell envelope stress conditions, as some UPP phosphatases like B. subtilis bcrC show stress-induced expression

  • Regulatory network mapping:

    • Test expression in strains lacking known cell envelope stress response regulators (σM, σX, LiaR)

    • Perform chromatin immunoprecipitation (ChIP) experiments to identify direct transcription factor binding

    • Consider global approaches like RNA-seq to place uppP1 regulation in the context of the entire cell envelope stress stimulon

  • Post-transcriptional regulation:

    • Investigate potential mRNA stability regulation

    • Examine the possibility of small RNA-mediated regulation

    • Consider translational efficiency through ribosome profiling

  • Post-translational regulation:

    • Test for modifications that might affect protein activity or stability

    • Investigate protein-protein interactions that could regulate uppP1 function

    • Examine subcellular localization patterns and how they might change under different conditions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.