Recombinant Bacillus licheniformis UPF0316 protein BLi00691/BL01474 (BLi00691, BL01474)

Shipped with Ice Packs
In Stock

Description

Overview of Bacillus licheniformis

Bacillus licheniformis is a Gram-positive, endospore-forming bacterium commonly found in soil and plants . It is closely related to Bacillus subtilis and is a facultative anaerobe, unlike most bacilli which are predominantly aerobic . B. licheniformis is valued for its ability to produce extracellular products, making it useful in industrial applications such as the production of biochemicals, enzymes, and antibiotics . This bacterium exhibits promise as a probiotic for treating dysbacteriosis due to its antimicrobial, antioxidant, and immunomodulatory activities .

Industrial and Biological Applications

B. licheniformis is used in various industrial processes to synthesize proteases (like α-amylase and penicillinase), specialty chemicals, and peptide antibiotics . The proteases are utilized in the detergent industry, while amylases are used for starch hydrolysis and textile processing . Certain strains of B. licheniformis also produce antimicrobial substances like bacteriocins, which are proteins or peptides with diverse structures . Some strains have demonstrated probiotic properties, showing protective effects against pathogens in animals and reducing pathogenic bacteria in those with chronic disease .

Antimicrobial Properties and Mechanisms

B. licheniformis produces a range of antimicrobial substances, including bacteriocins, which inhibit various bacteria and fungi . For example, a culture supernatant of B. licheniformis MKU3 showed bacteriocin-like activity against several Gram-positive bacteria and fungi, including Candida albicans . Similarly, B. licheniformis strain B116 exhibits antimicrobial activity against Staphylococcus aureus and Salmonella enterica ser. Pullorum . These bacteriocins are often stable at a wide range of pH and temperatures, but can be inactivated by proteinase K, trypsin, or pronase E . Some bacteriocins may also contain a lipid moiety, as indicated by inactivation through lipase .

Bacillus licheniformis as an Expression Platform

Bacillus licheniformis is recognized as an exceptional expression platform in biomanufacturing due to its ability to produce high-value products . Strong endogenous promoters, such as P<sub>bacA</sub> derived from the bacitracin synthase operon, are utilized to enhance the production of various compounds . Genetic manipulations, such as overexpressing specific operons and knocking out certain genes, can further increase the yields of desired products .

Proteomic Profiling and Antifungal Peptides

Liquid chromatography-tandem mass spectrometry (LC-MS/MS) has been used to identify extracellular proteins (ECP) of B. licheniformis, revealing their potential as antifungal peptides (AFPs) . These AFPs interact with virulent proteins of Candida albicans, forming hydrogen bonds and Pi-Pi interactions, suggesting their potential use in novel antifungal treatments .

Genomic Analysis

Genomic analysis of B. licheniformis strains reveals unique features and genetic diversity . Comparative genomic analysis, using tools like ANI calculators and OrthoANI tools, helps identify shared and unique genes among different strains . For example, analysis of B. licheniformis CBA7126 identified 4,108 shared genes and 137 unique genes compared to related strains .

Plant Growth-Promoting Rhizobacterium

Bacillus licheniformis YB06 has been identified as a plant growth-promoting rhizobacterium, enhancing the growth of Codonopsis pilosula and improving the structure and diversity of its rhizosphere soil microbial community . This strain can be used in biofertilizers and organic fertilizers, contributing to sustainable cultivation practices .

Enzymatic Activities and Probiotic Potential

Certain strains of Bacillus licheniformis exhibit multiple enzymatic activities, including phytase, protease, cellulase, and xylanase . These activities contribute to their probiotic potential, as they can degrade various compounds and improve nutrient availability . For instance, Bacillus licheniformis B4, isolated from camel feces, can survive in a wide range of pH and bile salt concentrations, and effectively degrade glycinin, β-conglycinin, and phytic acid .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
BLi00691; BL01474; UPF0316 protein BLi00691/BL01474
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)
Target Names
BLi00691
Target Protein Sequence
MLHSALLNGVIMVGIILVINIIYVTFLTLRMILTLKGQRYLAAFIGTIEMLVYVVGLGLV LDNLNQIQNVIAYAVGFGIGIIVGTKIEEKLALGYITVNAITKELDLDLPKQLREKGYGV THWVVGGLEGDRTAMQILTPRKYELQLYETIKSIDSKAFIISYEPKTIHGGFWVKAVKKR RIKE
Uniprot No.

Target Background

Database Links
Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the predicted structure and membrane topology of the UPF0316 protein?

The UPF0316 protein BLi00691/BL01474 is predicted to be a membrane protein containing a DUF2179 domain (Domain of Unknown Function) . Structural analysis suggests:

  • Contains multiple transmembrane regions, as evidenced by the hydrophobic amino acid clusters in the sequence

  • Features a highly conserved cytoplasmic domain at the C-terminus

  • Likely adopts an α-helical structure spanning the membrane multiple times

The membrane topology can be experimentally verified using techniques such as protease accessibility assays, fluorescence-based approaches with GFP fusions at different termini, or cysteine scanning mutagenesis followed by labeling with membrane-impermeable reagents .

How should recombinant UPF0316 protein BLi00691/BL01474 be stored to maintain stability?

For optimal stability of recombinant UPF0316 protein BLi00691/BL01474, follow these evidence-based storage procedures:

  • Short-term storage: Store working aliquots at 4°C for up to one week

  • Medium-term storage: Store at -20°C in storage buffer (typically Tris-based buffer with 50% glycerol)

  • Long-term storage: Conserve at -20°C or -80°C

Critical storage recommendations:

  • Avoid repeated freezing and thawing which significantly reduces biological activity

  • For lyophilized protein: Store in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Upon reconstitution, add glycerol (recommended final concentration 50%) and aliquot before freezing to minimize freeze-thaw cycles

Research indicates that heat treatment at 80°C and boiling for 10 minutes at pH 4.0 and 9.0 can significantly reduce biological activity of related proteins from B. licheniformis , suggesting the importance of maintaining appropriate pH and temperature conditions for storage.

What are the optimal expression systems for producing recombinant UPF0316 protein?

The selection of expression systems for UPF0316 protein production depends on research objectives and protein characteristics. Based on available data, several systems have proven effective:

Expression SystemAdvantagesConsiderationsTag Options
E. coliHigh yield, rapid growth, cost-effectiveMay require codon optimization, potential inclusion body formationN-terminal His, N-terminal 10xHis
Cell-free expressionEliminates cell viability concerns, suitable for membrane proteinsHigher cost, potentially lower yieldVariable according to system
Native B. licheniformisNatural folding environment, proper post-translational modificationsMore complex genetic manipulation requiredCan be engineered with various tags

For optimal expression in B. licheniformis itself, research has demonstrated that:

  • Using more than one ribosomal binding site (RBS) in the mRNA leader sequence significantly enhances translation efficiency and protein output

  • Incorporating six RBSs can increase protein production approximately 5-fold compared to a single RBS system

  • The P43 promoter from B. subtilis has been successfully used in B. licheniformis for strong protein expression

When expressing this membrane protein, detergent screening is often necessary to identify optimal solubilization conditions for maintaining native conformation and function .

How can I design an effective purification protocol for recombinant UPF0316 protein?

A systematic purification approach for recombinant UPF0316 protein typically includes:

  • Initial planning: Consider the addition of affinity tags (His tag being most common for this protein)

  • Cell lysis and membrane preparation:

    • For membrane proteins like UPF0316, gentle cell disruption methods are preferred

    • Differential centrifugation to isolate membrane fractions (30,000-100,000×g)

    • Membrane solubilization using appropriate detergents (test panel including DDM, LMNG, and CHAPS)

  • Chromatography sequence:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged protein

    • Size exclusion chromatography to remove aggregates and improve purity

    • Optional ion exchange chromatography as a polishing step

  • Quality control:

    • SDS-PAGE analysis should confirm purity ≥85-90%

    • Western blotting can verify protein identity

    • Mass spectrometry for confirmation of intact mass and sequence

For membrane proteins like UPF0316, maintaining the protein in appropriate detergent micelles throughout purification is critical to preserve structure and function. The purification buffer typically contains a detergent concentration above its critical micelle concentration (CMC).

What methods can be used to assess the functional activity of UPF0316 protein?

Since UPF0316 is a protein of unknown function, multiple complementary approaches should be employed to assess its functional activity:

  • Structural integrity assays:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Thermal shift assays to evaluate protein stability

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to determine oligomeric state

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with potential interacting partners

    • Bacterial two-hybrid screening

    • Crosslinking followed by mass spectrometry (XL-MS)

  • Membrane protein-specific assays:

    • Liposome reconstitution to assess membrane integration

    • Electrophysiology measurements if ion transport is suspected

    • Fluorescence-based transport assays if transporter function is hypothesized

  • In vivo functional assessment:

    • Gene knockout and complementation studies in B. licheniformis

    • Phenotypic characterization under various stress conditions (e.g., salt stress, as B. licheniformis shows strong gene expression changes under high salinity)

    • Heterologous expression in model organisms followed by phenotypic analysis

These methodological approaches should be guided by the observation that B. licheniformis responds significantly to stress conditions, particularly high salinity, which induces expression changes in membrane transport systems .

How does UPF0316 protein compare to other membrane proteins in Bacillus licheniformis, and what are the implications for bacterial stress response?

The UPF0316 protein represents one of several classes of membrane proteins in B. licheniformis with potential roles in stress response mechanisms. Comparative analysis reveals:

  • Structural comparison:

    • UPF0316 contains a unique DUF2179 domain not widely distributed across bacterial species

    • Unlike the ABC transporter proteins (e.g., BLi03671/BLi03672) that show dramatic upregulation (250-fold) under salt stress , UPF0316's expression pattern under stress remains to be fully characterized

  • Phylogenetic distribution:

    • While ABC transporters involved in stress response are widely conserved across Bacillus species, UPF0316 shows a more restricted distribution

    • Homologs exist primarily in closely related Bacillus species, suggesting specialized functions

  • Potential functional implications:

    • The membrane localization suggests potential roles in:

      • Small molecule transport

      • Signal transduction

      • Membrane integrity maintenance during stress conditions

    • May function in conjunction with B. licheniformis' extensive antimicrobial production system

Research has demonstrated that B. licheniformis possesses unique membrane-associated stress response mechanisms. For example, one of the strongest gene clusters inducible by high salinity encodes components of an ABC transport system (BLi03671 and BLi03672) that belongs to the exporter subfamily . Understanding UPF0316 in this context could reveal its potential role in the broader stress response network of this industrially important bacterium.

What approaches can be used to elucidate the role of UPF0316 protein in B. licheniformis antimicrobial production?

B. licheniformis produces several antimicrobial substances, including bacteriocins and other peptides with different structural and functional properties . To investigate UPF0316's potential role in this process:

  • Gene knockout studies:

    • Generate a UPF0316 deletion mutant using CRISPR/Cas9 systems optimized for B. licheniformis

    • The CRISPR/Cas9n system has achieved 100% editing efficiency for single genes in B. licheniformis

    • Assess changes in antimicrobial production profiles using bioassays against indicator strains

  • Protein localization and interaction studies:

    • Fluorescent protein tagging to determine subcellular localization

    • Proximity labeling methods (BioID, APEX) to identify neighboring proteins in the cell

    • Co-immunoprecipitation with known components of antimicrobial synthesis and export machinery

  • Transcriptional regulation analysis:

    • RNA-seq comparing wild-type and UPF0316 mutant strains under conditions that induce antimicrobial production

    • ChIP-seq if UPF0316 is suspected to interact with DNA or with transcriptional regulators

    • Use of inducible promoter systems (e.g., xylose-inducible or mannose-inducible promoters) to control UPF0316 expression levels

  • Metabolomic analysis:

    • Compare metabolite profiles between wild-type and UPF0316 mutant strains

    • Focus particularly on known antimicrobials produced by B. licheniformis:

      • Lichenicidin (a dipeptide lantibiotic with activity against Gram-positive bacteria)

      • Lichenin (a bacteriocin-like component produced under anaerobic conditions)

      • Bacitracins (with strong antimycobacterial activity)

B. licheniformis produces antimicrobial substances with activity against various pathogens, including Mycobacterium tuberculosis, Clostridium perfringens, and multiple Gram-positive bacteria . Understanding UPF0316's role could potentially enhance antimicrobial production or identify new antimicrobial pathways.

How might UPF0316 protein contribute to B. licheniformis' probiotic and immunomodulatory effects?

Research has established B. licheniformis as an effective probiotic with immunomodulatory properties . To investigate UPF0316's potential contribution:

  • Immunological studies:

    • Compare wild-type and UPF0316-deficient strains for their ability to modulate immune responses

    • Assess changes in cytokine profiles (IL-10, IL-6, IL-1β, TNF-α) and immunoglobulin levels (IgA, IgG, IgM)

    • Evaluate NLRP3 inflammasome activation patterns

  • Host-microbe interaction studies:

    • Cell culture models using intestinal epithelial cells and immune cells

    • Animal models to assess protection against pathogens like C. perfringens or LPS challenge

    • Analyze intestinal morphology parameters (villus height, crypt depth, V/C ratio)

Experimental evidence demonstrates that B. licheniformis supplementation:

  • Increases anti-inflammatory cytokine IL-10 and decreases pro-inflammatory cytokines IL-6 and IL-1β

  • Elevates levels of immunoglobulins, particularly IgA in serum and jejunal mucosa

  • Suppresses NLRP3 inflammasome activation in LPS-challenged animals

  • Increases concentrations of beneficial volatile fatty acids (VFAs) like propionic acid, acetic acid, and butyric acid in the colon

These findings suggest that membrane proteins like UPF0316 could potentially contribute to these effects through:

  • Mediating bacterial adhesion to host cells

  • Facilitating secretion of immunomodulatory compounds

  • Participating in stress responses that enable probiotic survival in the host

How should I design experiments to investigate protein-protein interactions involving UPF0316?

Investigating protein-protein interactions (PPIs) for membrane proteins like UPF0316 requires specialized approaches:

  • In vivo crosslinking:

    • Chemical crosslinkers with different spacer arm lengths (e.g., DSS, BS3)

    • Photo-activatable crosslinkers for spatial control

    • Formaldehyde for capturing transient interactions

  • Co-immunoprecipitation (Co-IP) optimization:

    • Detergent selection is critical: start with mild detergents (digitonin, DDM)

    • Consider covalent capture methods for transient interactions

    • Use appropriate controls including non-specific IgG and reciprocal pulldowns

  • Advanced methods for membrane protein PPIs:

    • Bimolecular Fluorescence Complementation (BiFC)

    • Förster Resonance Energy Transfer (FRET)

    • Split-ubiquitin yeast two-hybrid system (optimized for membrane proteins)

    • Proximity-dependent biotin identification (BioID)

  • Validation strategies:

    • Genetic validation through co-expression or co-deletion phenotypes

    • Functional assays to assess biological relevance of interactions

    • Structural validation when possible (e.g., cryoEM of complexes)

When designing these experiments, it's important to consider the native expression level of UPF0316 and its natural abundance in B. licheniformis membranes. The use of expression systems with tunable promoters, such as the mannose-inducible or xylose-inducible promoters characterized in B. licheniformis, allows for controlled expression levels during interaction studies .

What are the recommended approaches for developing high-quality research questions about UPF0316 protein?

Developing strong research questions about UPF0316 protein should follow established principles of question formulation in scientific research :

  • Criteria for high-quality research questions:

    • Focus: Target a single aspect of UPF0316 function or structure

    • Researchability: Ensure questions can be answered using available methods

    • Feasibility: Consider timeframe and practical constraints

    • Specificity: Frame questions that can be thoroughly answered

    • Complexity: Allow for development of multifaceted answers

    • Relevance: Connect to broader significance in microbiology or biotechnology

  • Question development process:

    • Begin with preliminary reading about UPF0316 and related membrane proteins

    • Identify research gaps through systematic literature review

    • Narrow focus to specific niches (e.g., stress response, antimicrobial production)

    • Frame questions according to research objectives

  • Question typology for UPF0316 research:

Research ObjectiveExample Research Question Formulation
Descriptive/ExploratoryWhat is the membrane topology of UPF0316 protein in B. licheniformis and how does it compare to homologs in related species?
Explanatory/TestingHow does deletion of the UPF0316 protein affect B. licheniformis' response to osmotic stress?
Evaluative/AppliedTo what extent does UPF0316 protein contribute to the antimicrobial activity of B. licheniformis against Clostridium perfringens?
  • From research problem to research question:

Research ProblemResearch Question
The function of UPF0316 protein in B. licheniformis remains unknown despite its conservation across Bacillus species.What molecular interactions does UPF0316 protein engage in under normal and stress conditions, and how do these interactions relate to cell survival?
B. licheniformis exhibits antimicrobial activity, but the role of membrane proteins in this process is poorly characterized.How does UPF0316 protein expression correlate with the production and export of antimicrobial compounds in B. licheniformis?

Remember that strong research questions should avoid subjective terms and value judgments, and should not demand conclusive solutions or courses of action .

What methodological approaches best support investigating the expression and regulation of UPF0316 protein in different growth conditions?

To comprehensively study UPF0316 expression and regulation under various conditions:

  • Transcriptional analysis approaches:

    • Quantitative reverse transcription-PCR (RT-qPCR) using reference genes such as adenylate kinase (adk) and 16S rRNA genes

    • RNA-seq to capture transcriptome-wide changes in expression

    • Promoter fusion reporters (e.g., GFP, luciferase) to monitor expression dynamics in real-time

  • Translational efficiency analysis:

    • Polysome profiling to assess translation dynamics

    • Ribosome profiling (Ribo-seq) for genome-wide translational status

    • Protein synthesis rate measurement using pulse-labeling techniques

  • Protein level quantification:

    • Western blotting with specific antibodies

    • Mass spectrometry-based proteomics (targeted or untargeted)

    • Fluorescent protein tagging for real-time visualization

  • Regulatory mechanism investigation:

    • Chromatin immunoprecipitation (ChIP) to identify transcription factor binding

    • Promoter mutation analysis to identify regulatory elements

    • CRISPR interference (CRISPRi) for targeted downregulation

Growth conditions to investigate should include:

  • Normal and stress conditions (osmotic, oxidative, temperature)

  • Different nutrient availabilities

  • Various growth phases (lag, exponential, stationary)

  • Anaerobic versus aerobic growth

  • Co-culture with other microorganisms

Research has shown that B. licheniformis gene expression changes dramatically under specific conditions. For example, certain transporters show up to 250-fold upregulation under high salinity , while production of antimicrobial compounds like lichenin occurs only under anaerobic conditions . Investigating UPF0316 expression under these varied conditions could provide important clues to its function.

What are the main challenges in expressing and purifying UPF0316 protein, and how can they be addressed?

Membrane proteins like UPF0316 present specific challenges during expression and purification:

  • Expression challenges and solutions:

ChallengeSolution ApproachesResearch Basis
Low expression levelsUtilize multiple RBS systems in B. licheniformis (up to 5-fold increase in protein output)The introduction of six RBSs can dramatically increase protein production in B. licheniformis
Protein toxicityUse tightly regulated inducible promoters (e.g., xylose or mannose-inducible systems)Inducible promoters can achieve controlled expression in B. licheniformis
Inclusion body formationLower induction temperature; co-express chaperones; use fusion tags (SUMO, MBP)Common practice for membrane protein expression
Improper membrane integrationExpress in native host (B. licheniformis) or use cell-free systemsCell-free systems can effectively express membrane proteins
  • Purification challenges and solutions:

ChallengeSolution ApproachesResearch Basis
Detergent selectionSystematic screening of detergent types and concentrationsCritical for maintaining protein stability and function
Maintaining stabilityInclude stabilizing additives (glycerol, specific lipids)Storage buffer with 50% glycerol is recommended
Protein aggregationMulti-step purification with immediate buffer optimizationPrevents loss of functional protein
Low purityCombination of affinity, ion exchange, and size exclusion chromatographyCan achieve >85-90% purity as determined by SDS-PAGE
  • Functional validation challenges:

    • Unknown function makes activity assays difficult to design

    • Solution: Use multiple indirect approaches (structural integrity, binding partners, in vivo complementation)

    • Consider comparative analysis with homologs of known function

Recent advances in B. licheniformis expression systems, including the development of multiple RBS technology and optimization of promoter systems , provide powerful tools to overcome these challenges.

How can contradictory experimental results about UPF0316 protein be reconciled and analyzed?

When facing contradictory results in UPF0316 protein research:

  • Systematic evaluation of experimental conditions:

    • Compare expression systems used (E. coli vs. B. licheniformis vs. cell-free)

    • Assess protein tags and their potential interference with function

    • Examine buffer compositions and their effects on protein behavior

    • Consider strain backgrounds and genetic contexts

  • Methodological approaches to reconciliation:

    • Perform side-by-side comparisons under identical conditions

    • Use multiple orthogonal techniques to validate key findings

    • Conduct meta-analysis of available data to identify patterns

    • Consider whether contradictions reflect true biological variability

  • Advanced analytical framework:

Contradiction TypeInvestigation ApproachResolution Strategy
Functional assignmentMultiple function assessment techniquesDetermine if protein has multiple or context-dependent functions
Structural discrepanciesAssess conditions affecting protein conformationConsider dynamism or multiple conformational states
Expression pattern differencesStandardize growth conditions and analysis methodsIdentify variables affecting expression (media, growth phase)
Interaction partner disagreementsUse multiple interaction methods with proper controlsMap interaction networks rather than isolated interactions
  • Reporting recommendations:

    • Clearly document all experimental conditions

    • Report negative and contradictory results

    • Suggest testable hypotheses to explain contradictions

    • Frame contradictions as opportunities for discovery

The multiperspectival approach described in contemporary research methodologies is particularly valuable here, as it allows examination of contradictory results from different theoretical and methodological angles, potentially revealing complementary rather than truly contradictory findings.

What control experiments are essential when studying the function of UPF0316 protein in B. licheniformis?

  • Genetic manipulation controls:

    • Empty vector controls for overexpression studies

    • Complementation controls for knockout studies (restore wild-type phenotype)

    • Non-targeting guide RNA controls for CRISPR experiments

    • Strain background characterization to account for variation

  • Protein-level controls:

    • Inactive mutant versions (e.g., point mutations in conserved residues)

    • Tagged vs. untagged protein comparisons to assess tag effects

    • Expression level confirmation (Western blot, qPCR)

    • Subcellular localization verification

  • Functional assay controls:

    • Positive controls with proteins of known function

    • Negative controls with unrelated proteins

    • Dose-response relationships to establish specificity

    • Time-course studies to capture dynamic processes

  • Environmental condition controls:

    • Media composition standardization

    • Growth phase matching across experiments

    • Temperature, pH, and oxygen level monitoring

    • Stress condition application validation

  • Essential validation experiments:

Research QuestionControl ExperimentRationale
UPF0316 role in stress responseTest multiple stress types and intensitiesDistinguish specific from general effects
Protein-protein interactionsInclude non-specific binding controls and competition assaysEstablish specificity of interactions
Impact on antimicrobial productionQuantify effects on multiple antimicrobial compoundsDetermine if effects are compound-specific
Contribution to membrane integrityCompare effects to known membrane protein knockoutsPosition effects within known pathways

When studying UPF0316 in the context of B. licheniformis' antimicrobial or probiotic properties, it's particularly important to include pathogen challenge controls and standardized methods for measuring outcomes like growth performance, intestinal morphology, and immune parameters .

What emerging technologies could advance our understanding of UPF0316 protein function?

Several cutting-edge technologies hold promise for elucidating UPF0316 function:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy for membrane protein structures

    • Microcrystal electron diffraction (MicroED) for small crystals

    • Solid-state NMR for membrane protein dynamics

    • AlphaFold2 and related AI structure prediction tools

  • Functional genomics technologies:

    • CRISPRi for tunable gene repression in B. licheniformis

    • CRISPR activation (CRISPRa) for upregulation studies

    • Multiplexed genome engineering for pathway analysis

    • BarSeq approaches for high-throughput phenotyping

  • Single-cell and spatial technologies:

    • Single-cell RNA-seq to capture heterogeneity in bacterial populations

    • Spatial transcriptomics to map expression in biofilms or host tissues

    • Super-resolution microscopy for precise localization

    • Single-molecule tracking to study dynamics

  • Systems biology integration:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics)

    • Flux balance analysis for metabolic impacts

    • Machine learning for pattern recognition in complex datasets

    • Network analysis to position UPF0316 in cellular pathways

Recent developments in B. licheniformis genetic engineering are particularly promising, including the CRISPR/Cas9n gene editing system that achieves 100% editing efficiency for single genes , and the mannose-induced CRISPRi system that can achieve 84% downregulation of transcription . These tools enable precise manipulation of UPF0316 expression and function.

How can interdisciplinary approaches enhance research on UPF0316 protein and B. licheniformis?

Interdisciplinary research strategies can unlock new insights into UPF0316 function:

  • Computational biology and bioinformatics:

    • Evolutionary analysis across Bacillus species

    • Protein-protein interaction prediction

    • Molecular dynamics simulations in membrane environments

    • Machine learning for function prediction from sequence

  • Synthetic biology approaches:

    • Design of minimal cellular systems with UPF0316

    • Circuit engineering to report on UPF0316 activity

    • Development of advanced expression systems for B. licheniformis

    • Creation of protein chimeras to probe domain functions

  • Host-microbe interaction studies:

    • Animal models to assess B. licheniformis and UPF0316 in vivo

    • Organoid systems for controlled environment studies

    • Microbiome analysis in the presence of engineered strains

    • Immunological profiling of host responses

  • Industrial biotechnology perspectives:

    • Process optimization for enhanced protein production

    • Bioreactor design for optimal B. licheniformis growth

    • Downstream processing improvements

    • Scale-up considerations for research applications

The interdisciplinary approach aligns with contemporary research methodologies described in the literature, such as the Multiperspectival Approach that combines different theoretical and methodological perspectives to generate richer insights . This is particularly valuable for studying proteins like UPF0316 whose functions span multiple biological processes.

What are the most promising research questions about UPF0316 protein that remain to be addressed?

Several high-priority research questions about UPF0316 protein warrant investigation:

  • Structural and functional characterization:

    • What is the high-resolution structure of UPF0316 protein, and how does it compare to other membrane proteins?

    • Does UPF0316 function as a transporter, signaling protein, or structural component of the membrane?

    • How does the protein topology relate to its function in the membrane?

  • Regulatory networks:

    • What transcription factors control UPF0316 expression?

    • How is UPF0316 expression modulated in response to environmental stresses?

    • Does UPF0316 participate in quorum sensing or other bacterial communication systems?

  • Role in B. licheniformis biology:

    • How does UPF0316 contribute to B. licheniformis' distinctive capacity to produce antimicrobial compounds?

    • What is the relationship between UPF0316 and the bacterium's exceptional stress tolerance?

    • Does UPF0316 play a role in the formation or germination of endospores?

  • Biotechnological applications:

    • Can UPF0316 be engineered to enhance protein production in B. licheniformis?

    • Does UPF0316 contribute to the probiotic and immunomodulatory properties of B. licheniformis?

    • Could UPF0316 serve as a target for enhancing antimicrobial production?

These questions should be approached using the principles of strong research question development , ensuring they are focused, researchable, feasible, specific, complex, and relevant to the field. The combined application of genetic, biochemical, and computational approaches will be necessary to address these complex questions effectively.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.