Recombinant Bacillus licheniformis UPF0344 protein BLi01172/BL01343 (BLi01172, BL01343)

What is UPF0344 protein BLi01172/BL01343 and what is its function in Bacillus licheniformis?

UPF0344 protein BLi01172/BL01343 is a membrane protein expressed in Bacillus licheniformis (strain DSM 13 / ATCC 14580), consisting of 118 amino acids. The protein belongs to the UPF0344 family of uncharacterized proteins, with the designation "UPF" indicating that its precise function remains to be fully elucidated. Analysis of its amino acid sequence (MTHMHITSWVIALILVFVAYGLYSSGNSKGAKITHMILRLFYIIVIITGAQLFLKFTAWNGEYIAKALLGLITIGFMEMLLIRRKNGRKATGIWIGFIVVLLLTYVLGLRLPLGFKVF) reveals multiple hydrophobic regions characteristic of transmembrane proteins .

Computational and experimental analyses suggest that this protein may play a role in membrane integrity, transport processes, or stress response pathways. The conservation of this protein family across various Bacillus species indicates evolutionary importance, potentially in environmental adaptation mechanisms. Current research points toward its involvement in cellular processes related to environmental stress tolerance, which aligns with B. licheniformis' known ability to thrive in diverse ecological niches.

What are the recommended handling protocols for recombinant UPF0344 protein?

The optimal handling of recombinant UPF0344 protein BLi01172/BL01343 requires careful attention to storage conditions and freeze-thaw cycles. The protein should be stored at -20°C for regular use, or at -80°C for extended storage periods . Working aliquots can be maintained at 4°C for up to one week to minimize degradation from repeated freeze-thaw cycles, which should be avoided whenever possible .

The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized for stability . When handling the protein for experimental purposes, maintain sterile conditions and use low-protein binding tubes to prevent adsorption loss. If dilution is necessary, use the same buffer composition to maintain protein stability. For membrane protein studies, consider supplementing buffers with mild detergents (0.01-0.05% DDM or 0.1% CHAPS) to prevent aggregation while maintaining native-like conformations.

How does the structure of UPF0344 protein relate to its potential function?

Structural analysis of the UPF0344 protein BLi01172/BL01343 indicates it contains multiple transmembrane helices with characteristic hydrophobic regions. The 118-amino acid sequence features a distinctive pattern of hydrophobic and hydrophilic residues consistent with a membrane-spanning topology . Computational topology predictions suggest 3-4 transmembrane domains with short connecting loops and termini extending into either the cytoplasm or extracellular space.

The structural features of UPF0344 protein bear similarities to known membrane transporters and channels, particularly in the arrangement of its transmembrane segments. The presence of conserved charged residues (including lysine and arginine) in predicted transmembrane boundaries suggests potential involvement in substrate recognition or membrane anchoring. Table 1 summarizes the predicted structural elements based on computational analysis:

These structural characteristics provide foundation for research hypotheses regarding potential functions in transport, signaling, or membrane organization.

What expression systems are most effective for UPF0344 protein production?

The expression of UPF0344 protein BLi01172/BL01343 can be achieved through various systems, with B. licheniformis itself serving as an excellent expression platform due to its natural ability to produce high-value products . When designing expression systems for this membrane protein, the following approaches have demonstrated superior results:

For homologous expression in B. licheniformis, strong constitutive promoters derived from the bacitracin synthase operon (PbacA) or the acetoin operon (PalsSD) have shown high expression levels . These promoters naturally function in B. licheniformis and can drive strong expression without external inducers. Alternatively, the mannose-inducible promoter (Pman) offers regulated expression with up to 84% induction efficiency upon mannose addition .

For heterologous expression, modified E. coli strains (C41/C43) specifically engineered for membrane protein expression yield better results than standard BL21 strains. Expression protocols typically require:

• Lower induction temperatures (16-20°C)

• Reduced IPTG concentrations (0.1-0.3 mM)

• Extended expression times (16-24 hours)

• Supplementation with membrane-stabilizing compounds

The expression yield can be further optimized by incorporating fusion tags (such as MBP or SUMO) that enhance solubility while maintaining the integrity of transmembrane domains.

What purification strategies optimize yield and purity of recombinant UPF0344 protein?

Purification of recombinant UPF0344 protein presents challenges typical of membrane proteins. A multi-step purification strategy yields optimal results:

First, membrane isolation through differential centrifugation following cell lysis (typically using a French press or sonication) creates an enriched starting material. Subsequent membrane solubilization requires careful detergent selection—mild detergents like n-dodecyl-β-D-maltoside (DDM) at 1% concentration effectively solubilize the protein while preserving structural integrity.

Affinity chromatography utilizing histidine or other fusion tags provides initial purification, followed by size exclusion chromatography to remove aggregates and ensure homogeneity. Table 2 summarizes purification yields using different approaches:

The purified protein should be stored in buffer containing 50% glycerol at -20°C for routine storage or -80°C for extended preservation . Maintaining a low concentration of detergent in the storage buffer prevents protein aggregation.

How can researchers assess the functional activity of UPF0344 protein?

As UPF0344 is an uncharacterized protein family, functional assessment requires multiple complementary approaches:

• Membrane Reconstitution Assays: Incorporating the purified protein into liposomes or nanodiscs allows assessment of potential transport activities. Fluorescent or radioactive substrate tracking across these artificial membranes can reveal transport function.

• Binding Assays: Thermal shift assays (differential scanning fluorimetry) with candidate ligands may identify molecules that stabilize the protein, suggesting binding partners.

• Genetic Approaches: Creating knockout mutants (ΔBLi01172/BL01343) in B. licheniformis and assessing phenotypic changes under various stress conditions (osmotic, heat, pH, antimicrobial exposure) can provide functional insights.

• Proteomic Interaction Studies: Cross-linking followed by mass spectrometry or pull-down assays can identify protein interaction partners, clarifying the molecular context in which UPF0344 functions.

• Electrophysiological Measurements: If channel activity is suspected, patch-clamp techniques on reconstituted systems can measure ion conductance and selectivity.

The combination of these approaches produces a comprehensive functional profile, particularly valuable for understudied membrane proteins like UPF0344.

How can CRISPR-Cas systems be utilized to study UPF0344 protein function in Bacillus licheniformis?

CRISPR-Cas technology offers powerful approaches for investigating UPF0344 protein function in B. licheniformis through genome editing and transcriptional regulation. The CRISPR/Cas9n gene editing system has demonstrated efficient gene modification capabilities in B. licheniformis, with reported efficiencies of 100% for single gene edits and 79.0% for large fragment modifications .

For studying UPF0344, researchers can implement:

• Knockout Studies: Complete deletion of BLi01172/BL01343 genes to assess the resulting phenotype. Target design should account for potential polar effects if these genes are part of an operon.

• Point Mutations: Creating specific amino acid substitutions at conserved residues to identify functionally critical domains. This approach is particularly valuable for transmembrane proteins where complete deletion may be lethal.

• CRISPRi Approaches: Using a deactivated Cas9 (dCas9) system under mannose-inducible promoter control allows for tunable downregulation of gene expression without complete elimination. The mannose-induced CRISPRi system in B. licheniformis has demonstrated downregulation efficiency of up to 84% .

• Promoter Replacement: Substituting the native promoter with characterized inducible promoters such as the xylose-inducible promoter allows for controlled expression studies. This approach can help determine whether the protein's function is essential under certain conditions.

The design of guide RNAs should consider the high GC content often found in B. licheniformis genes and potential off-target effects. Validating genomic modifications requires sequencing and comprehensive phenotypic characterization under various environmental conditions.

What approaches are most effective for studying membrane topology of UPF0344 protein?

Determining the membrane topology of UPF0344 protein requires multiple complementary experimental approaches:

• Cysteine Scanning Mutagenesis: Systematically replacing residues with cysteine throughout the protein sequence, followed by accessibility assays using membrane-permeable and impermeable sulfhydryl reagents. This establishes which regions are exposed to either side of the membrane.

• Fusion Reporter Techniques: Creating fusion constructs with reporter proteins (GFP, PhoA, or LacZ) at different positions can indicate cytoplasmic or extracellular localization based on reporter activity.

• Protease Protection Assays: Limited proteolysis of membrane preparations followed by mass spectrometry analysis identifies accessible regions versus protected transmembrane domains.

• FRET-Based Approaches: Using fluorescent protein pairs to measure distances between protein regions can validate predicted structural arrangements.

Table 3 presents a proposed experimental design for topology mapping:

Combined results from these approaches produce a definitive topological map that can inform structure-function relationship studies and guide protein engineering efforts.

How can researchers investigate the potential role of UPF0344 in antimicrobial resistance mechanisms?

B. licheniformis is known for producing various antimicrobial substances, including bacteriocins and non-ribosomally synthesized peptides . Investigating whether UPF0344 protein contributes to antimicrobial resistance or production mechanisms requires several specialized approaches:

• Comparative Expression Analysis: Quantitative RT-PCR or RNA-seq comparing UPF0344 expression levels in wild-type strains versus strains exposed to antibiotics or competing microorganisms. Correlations between expression changes and resistance phenotypes may indicate functional involvement.

• Protein-Antibiotic Interaction Studies: Surface plasmon resonance or isothermal titration calorimetry to detect direct binding between purified UPF0344 protein and various antibiotics.

• Resistance Profiling: Determining minimum inhibitory concentrations (MICs) of various antimicrobials against wild-type, UPF0344 overexpression, and knockout strains. Significant changes in MIC values would suggest involvement in resistance mechanisms.

• Metabolomic Analysis: Comparing metabolite profiles between wild-type and UPF0344 mutant strains may reveal alterations in antimicrobial compound production. This is particularly relevant given B. licheniformis' capacity to produce various antimicrobial compounds like bacteriocins .

• Membrane Permeability Assays: Fluorescent dye uptake experiments can determine whether UPF0344 affects membrane permeability to antimicrobial compounds.

The experimental design should include appropriate controls and multiple B. licheniformis strains to account for strain-specific variations in antimicrobial production and resistance mechanisms.

What are the major challenges in crystallizing UPF0344 protein for structural analysis?

Crystallizing membrane proteins like UPF0344 presents significant challenges that require specialized approaches. The primary difficulties include:

• Protein Stability: Maintaining the native conformation of UPF0344 outside its membrane environment requires careful detergent selection. Initial screening should include a panel of detergents (DDM, LMNG, OG, LDAO) at varying concentrations to identify optimal solubilization conditions.

• Crystal Packing Limitations: The detergent micelle surrounding the hydrophobic transmembrane regions limits crystal contact formation. Techniques to overcome this include:

  • Using antibody fragments (Fab or nanobodies) to increase the hydrophilic surface area

  • Employing fusion partners like T4 lysozyme or BRIL in predicted loop regions

  • Utilizing lipidic cubic phase (LCP) crystallization methods

• Conformational Heterogeneity: Membrane proteins often exhibit multiple conformations, hindering crystal formation. Stabilizing agents like lipids (specifically those found in B. licheniformis membranes) or potential ligands can reduce this heterogeneity.

• Protein Production Scale: Obtaining sufficient quantities of pure, homogeneous protein requires large-scale expression. For UPF0344, yields can be improved by using strong constitutive promoters like PbacA or PalsSD in B. licheniformis expression systems .

Table 4 outlines a strategic approach to UPF0344 crystallization:

If crystallization proves challenging, alternative structural approaches like cryo-electron microscopy (cryo-EM) or nuclear magnetic resonance (NMR) for specific protein domains should be considered.

How can molecular dynamics simulations complement experimental studies of UPF0344 protein?

Molecular dynamics (MD) simulations provide valuable insights into UPF0344 protein behavior within membrane environments, complementing experimental approaches:

• Membrane Integration Analysis: All-atom MD simulations can predict the stable orientation of UPF0344 within lipid bilayers, identifying preferred lipid interactions and membrane deformations. This is particularly valuable for membrane proteins where experimental determination of precise positioning is challenging.

• Functional Mechanism Prediction: MD simulations can identify potential substrate binding sites and transport pathways by analyzing cavities, water-accessible regions, and electrostatic properties. For UPF0344, simulations may reveal channel-like features or substrate binding pockets not evident from sequence analysis alone.

• Conformational Dynamics: Simulations on microsecond timescales can capture conformational changes relevant to function, particularly transitions between open and closed states if UPF0344 functions as a transporter or channel.

• Mutation Impact Prediction: In silico mutations at conserved residues can predict functional impacts before experimental validation, guiding site-directed mutagenesis studies.

Simulation protocols should include:

• Multiple replicate simulations (minimum 3) of sufficient duration (>100 ns each)

• Testing in different membrane compositions, including B. licheniformis-like lipid environments

• Enhanced sampling techniques (metadynamics, replica exchange) to explore rare conformational events

• Validation against available experimental data on membrane protein behavior

MD simulations can generate testable hypotheses about UPF0344 function that direct subsequent experimental work, creating an iterative research cycle between computational prediction and experimental verification.

How does UPF0344 protein sequence conservation correlate with functional predictions across Bacillus species?

Evolutionary analysis of UPF0344 protein provides critical insights into functionally important regions and potential specialization across Bacillus species. Sequence conservation patterns reveal:

• Core Conserved Domains: Multiple sequence alignment of UPF0344 homologs across Bacillus species identifies highly conserved residues, likely essential for structural integrity or function. These typically include specific glycine residues in transmembrane regions that provide flexibility and charged residues at membrane interfaces.

• Species-Specific Variations: Regions showing higher variability between species may indicate adaptation to specific ecological niches or functional specialization. B. licheniformis, known for its ability to produce antimicrobial substances , may contain unique sequence features in UPF0344 compared to non-antimicrobial-producing species.

• Coevolution Analysis: Statistical coupling analysis (SCA) or direct coupling analysis (DCA) can identify co-evolving residue pairs, suggesting physical interaction or functional coupling within the protein structure.

Table 5 presents a conservation analysis across selected Bacillus species:

Phylogenetic analysis integrated with functional annotation of related species can further refine functional predictions. Proteins showing highest sequence similarity to UPF0344 in B. licheniformis from antimicrobial-producing species may suggest involvement in common cellular processes related to antimicrobial production or resistance.

What experimental approaches can validate computational predictions about UPF0344 protein function?

Bridging computational predictions with experimental validation requires a systematic approach:

The experimental design should include appropriate controls and multiple replicate experiments to ensure reproducibility. Results should be analyzed quantitatively using statistical methods appropriate for the specific experimental approach employed.