Recombinant Bacillus licheniformis UPF0365 protein BLi02729/BL01411 (BLi02729, BL01411)

Shipped with Ice Packs
In Stock

Description

Introduction

Bacillus licheniformis is a Gram-positive bacterium recognized for its ability to produce high-value products, making it an exceptional expression platform in biomanufacturing . It produces several antimicrobial substances, including bacteriocins, which are peptides or proteins with differing structural characteristics . Recombinant Bacillus licheniformis UPF0365 protein BLi02729/BL01411 (BLi02729, BL01411) is a protein that can be expressed in Bacillus licheniformis using genetic engineering techniques to enhance protein production .

Production and Enhancement of Protein Expression

One approach to improving protein production in B. licheniformis involves engineering a novel mRNA leader sequence that contains multiple ribosomal binding sites (RBS) . This can initiate translation from multiple sites, thereby significantly enhancing the translation efficiency of the industrial strain Bacillus licheniformis . The protein expression levels are positively correlated with the number of RBSs within the mRNA leader region .

Number of RBSsEffect on Fluorescence Intensity of GFP
One to FourDramatic improvement
Four to SixDiminishing increases
Six5-fold higher than with a single RBS

When the number of RBSs within an mRNA leader sequence reaches six, the production of green fluorescent protein (GFP) can exceed 50% of the total intracellular protein, representing a substantial increase in protein production .

Applications of BLi02729/BL01411

While specific applications of the UPF0365 protein BLi02729/BL01411 were not found in the aggregated documents, acyltransferase, an enzyme derived from Bacillus licheniformis, has various applications as a processing aid to improve emulsification in food and food manufacturing processes, such as :

  • Egg yolk and whole eggs to avoid product separation during high-temperature processing in mayonnaise production

  • Processed meat products to improve fat emulsification, enhancing consistency and reducing cooking loss

  • Degumming of vegetable oils

  • Production of UHT and powdered milk to reduce fouling

  • Yogurt production to facilitate fermentation and improve viscosity

  • Bakery products containing eggs to provide a softer and more tender crumb

Modification of Carbon Source Utilization

Bacillus licheniformis exhibits selective utilization of carbon sources, a process mainly governed by catabolite control protein A (CcpA) . The DNA-binding domain of B. licheniformis CcpA contains four α-helices, with specific amino acids like Arg22 and Leu56 playing a crucial role in the interaction of CcpA with catabolite responsive element (cre) sites .

Fermentation and Probiotic Potential

Bacillus licheniformis can be used in soybean meal fermentation to enhance its nutritional value . Fermentation with specific strains like Bacillus licheniformis (B4) can significantly reduce phytic acid content and decrease neutral detergent fiber (NDF) and acid detergent fiber (ADF) levels .

AnalysisUnfermented SBM (UF-SBM)Fermented SBM (F-SBM) 24hFermented SBM (F-SBM) 48h
Degree of Protein Hydrolysis15.9%25.5%-
Crude Protein Concentration44.8%52.5%54.3%
NDF Reduction Relative to UF-SBM-38.4%35.27%
ADF Reduction Relative to UF-SBM-30.20%14.3%

Bacillus licheniformis strains can also function as probiotics, demonstrating tolerance to different pH levels and bile salt concentrations, and exhibiting high proliferative activity at elevated temperatures .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is finalized during production. If you require a particular tag, please specify it in your order for preferential development.
Synonyms
floA; BLi02729; BL01411; Flotillin-like protein FloA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-330
Protein Length
full length protein
Species
Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)
Target Names
BLi02729
Target Protein Sequence
MDPSTLFLLLIIAAGIILLAVFFTFVPVMLWISALAAGVKISIFTLIGMRLRRVIPNRVV NPLIKAHKAGLDVAINQLESHYLAGGNVDRVVNALIAAQRANIELTFARCAAIDLAGRDV LEAVQMSVNPKVIETPFIAGVAMDGIEVKAKARITVRANIDRLVGGAGEETIIARVGEGI VSTIGSSDNHKKVLENPDMISQTVLSKGLDSGTAFEILSIDIADVDIGKNIGAILQTDQA EADKNIAQAKAEERRAMAVAQEQEMRARVEEMRAKVVEAEAEVPLAMSEALRSGKIGVMD YLNMKNIDADTDMRDSFGKMTKDQNEEDHK
Uniprot No.

Target Background

Function

Found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. FMMs exhibit high dynamism and increase in number with cellular aging. Flotillins are believed to play a significant role in regulating membrane fluidity.

Database Links
Protein Families
UPF0365 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.

Q&A

What is BLi02729/BL01411 protein and what organism does it originate from?

BLi02729/BL01411 is a UPF0365 protein from Bacillus licheniformis, also known as Flotillin-like protein FloA (UniProt ID: Q65H64). It is a full-length protein consisting of 330 amino acids. B. licheniformis is a gram-positive, mesophilic bacterium commonly found in soil and on bird feathers, especially chest and back plumage of ground-dwelling and aquatic birds . The bacterium can exist in a dormant spore form to resist harsh environments or in a vegetative state under favorable conditions .

How is recombinant BLi02729/BL01411 protein typically produced for research purposes?

Recombinant BLi02729/BL01411 protein is typically produced using E. coli expression systems. The full-length protein (amino acids 1-330) is cloned and expressed with an N-terminal His tag to facilitate purification. The protein is then purified using affinity chromatography methods and provided as a lyophilized powder for research applications . This approach allows for high-yield production of the protein while maintaining its structural integrity for experimental studies.

What are the recommended storage and reconstitution conditions for recombinant BLi02729/BL01411 protein?

The recommended storage and reconstitution conditions for optimal stability and activity of recombinant BLi02729/BL01411 protein are:

ParameterRecommended Condition
StorageStore at -20°C/-80°C upon receipt
AliquotingNecessary for multiple use to avoid repeated freeze-thaw cycles
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to 0.1-1.0 mg/mL
Long-term StorageAdd 5-50% glycerol (final concentration) and store at -20°C/-80°C
Working StorageAliquots may be stored at 4°C for up to one week

Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and activity .

How can researchers verify the purity and integrity of recombinant BLi02729/BL01411 protein?

To verify the purity and integrity of recombinant BLi02729/BL01411 protein, researchers should employ a multi-method approach:

  • SDS-PAGE Analysis: Run the protein on an SDS-PAGE gel to confirm the expected molecular weight (~38 kDa including the His-tag) and assess purity. Commercial preparations typically achieve >90% purity as determined by SDS-PAGE .

  • Western Blotting: Use anti-His antibodies to confirm the presence of the His-tagged protein.

  • Mass Spectrometry: For more detailed characterization, mass spectrometry can verify the exact mass and confirm the protein sequence.

  • Circular Dichroism: To assess proper folding and secondary structure elements.

  • Size Exclusion Chromatography: To evaluate aggregation state and homogeneity of the protein preparation.

This comprehensive approach ensures both the identity and structural integrity of the protein for downstream applications.

What experimental approaches can be used to study the membrane association of BLi02729/BL01411?

Since BLi02729/BL01411 is described as a flotillin-like protein with potential membrane association, several approaches are recommended to study this characteristic:

  • Membrane Fractionation: Separate cellular fractions (cytosolic, membrane, and detergent-resistant membrane domains) through differential centrifugation and detergent extraction methods.

  • Fluorescence Microscopy: Express the protein fused to a fluorescent tag (e.g., GFP) to visualize its subcellular localization in live cells.

  • Lipid Binding Assays: Use protein-lipid overlay assays or liposome binding experiments to determine specific lipid interactions.

  • FRET Analysis: To study potential protein-protein interactions within membrane domains.

  • Cryo-Electron Microscopy: For detailed structural analysis of the protein within membrane contexts.

These methods provide complementary information about the protein's membrane interactions and can help elucidate its functional role in cellular processes.

How might BLi02729/BL01411 contribute to the antimicrobial properties of Bacillus licheniformis?

B. licheniformis is known to produce various antimicrobial substances including bacteriocins, non-ribosomally synthesized peptides, cyclic lipopeptides, and exopolysaccharides that are active against a range of pathogens . While the direct role of BLi02729/BL01411 in antimicrobial activity is not explicitly established in the available literature, several hypotheses can be investigated:

  • As a flotillin-like protein, BLi02729/BL01411 may organize membrane microdomains that serve as platforms for secretion systems delivering antimicrobial compounds.

  • It may participate in cell signaling pathways that regulate the production of antimicrobial substances like licheniformins, which have shown activity against Mycobacterium tuberculosis, Staphylococcus aureus, and Escherichia coli .

  • It could be involved in biofilm formation, which is known to enhance antimicrobial compound production in many Bacillus species.

Methodological approach: Researchers could generate knockout mutants of the BLi02729/BL01411 gene and assess changes in antimicrobial activity, membrane organization, and secretion efficiency compared to wild-type strains.

What protein engineering strategies could be applied to study or modify BLi02729/BL01411 function?

Several protein engineering approaches can be employed to study or modify BLi02729/BL01411 function:

  • Site-Directed Mutagenesis: Create point mutations in conserved domains to identify critical residues for function.

  • Domain Swapping: Exchange domains with related proteins to create chimeras for functional analysis.

  • Loop Engineering: As demonstrated with other bacterial proteins, loop modifications can alter protein function. The loop engineering approach described for hexosaminidases in search result could be adapted to BLi02729/BL01411, particularly if specific loop regions are identified through sequence alignment with related proteins.

  • Peptide Pattern Recognition Analysis: This approach can categorize proteins into functional subgroups, helping to identify critical regions for engineering .

  • Directed Evolution: Create libraries of protein variants and screen for enhanced or novel functions.

A methodical approach would begin with computational analysis to identify conserved domains and variable regions, followed by targeted modifications and functional assays specific to the protein's predicted role.

How can researchers investigate protein-protein interactions involving BLi02729/BL01411?

To investigate protein-protein interactions involving BLi02729/BL01411, researchers can employ the following methodological approaches:

  • Pull-down Assays: Use His-tagged BLi02729/BL01411 as bait to identify interacting proteins from B. licheniformis lysates.

  • Yeast Two-Hybrid Screening: Identify potential interaction partners through library screening.

  • Co-immunoprecipitation: If antibodies against BLi02729/BL01411 are available, use them to co-precipitate interacting proteins.

  • Crosslinking Mass Spectrometry: Identify proteins in close proximity to BLi02729/BL01411 in vivo.

  • Bacterial Two-Hybrid Systems: Adapted for prokaryotic protein interactions.

  • Förster Resonance Energy Transfer (FRET): To study interactions in real-time in living cells.

  • Genetic Approaches: Look for synthetic lethal interactions or suppressor mutations.

Data from these experiments should be validated through multiple techniques and analyzed in the context of genetic associations with protein ratios, which can reveal new regulatory mechanisms as described in recent research .

What computational methods are appropriate for predicting the structure and function of BLi02729/BL01411?

For predicting the structure and function of BLi02729/BL01411, researchers should consider a multi-layered computational approach:

  • Homology Modeling: Since BLi02729/BL01411 is a flotillin-like protein, structures of related flotillins can serve as templates. Tools like AlphaFold2 or SWISS-MODEL are particularly useful.

  • Molecular Dynamics Simulations: To study the behavior of the protein within membrane environments and predict lipid interactions.

  • Protein-Protein Docking: To predict potential interaction partners based on structural complementarity.

  • Sequence-Based Function Prediction: Tools like InterProScan and Pfam can identify functional domains and motifs.

  • Evolutionary Analysis: Multiple sequence alignments and phylogenetic analysis to identify conserved regions that may be functionally important.

  • Protein Disorder Prediction: To identify potentially disordered regions that might be involved in protein-protein interactions.

  • Membrane Topology Prediction: To identify transmembrane regions and orientation relative to the membrane.

The results from these computational analyses should guide experimental design, particularly for site-directed mutagenesis and functional studies.

How can genetic approaches be used to elucidate the physiological role of BLi02729/BL01411 in Bacillus licheniformis?

To elucidate the physiological role of BLi02729/BL01411 in B. licheniformis, researchers can implement the following genetic approaches:

  • Gene Knockout/Knockdown: Create deletion mutants or use CRISPR interference (CRISPRi) to reduce expression, then characterize phenotypic changes in various conditions.

  • Complementation Studies: Reintroduce the wild-type or mutant genes into knockout strains to confirm phenotypes and study structure-function relationships.

  • Overexpression Analysis: Study the effects of increased protein levels on cellular physiology and antimicrobial production.

  • Reporter Fusions: Create transcriptional or translational fusions to monitor expression patterns under different conditions.

  • Quantitative Trait Loci (QTL) Analysis: Similar to approaches used in study , identify genetic associations with BLi02729/BL01411 expression levels or ratios to other proteins.

  • Conditional Expression Systems: Use inducible promoters to control gene expression and study time-dependent effects.

  • Transposon Mutagenesis: Identify synthetic lethal interactions or genetic modifiers.

These approaches can reveal the protein's role in specific cellular processes, particularly in the context of the bacterium's known antimicrobial activities and environmental adaptations.

How might research on BLi02729/BL01411 contribute to understanding antimicrobial resistance mechanisms?

Research on BLi02729/BL01411 could contribute to understanding antimicrobial resistance mechanisms through several avenues:

  • B. licheniformis produces various antimicrobial compounds including licheniformins that have shown activity against Mycobacterium tuberculosis and other pathogens . If BLi02729/BL01411 plays a role in the production, regulation, or secretion of these compounds, understanding its function could provide insights into novel antimicrobial mechanisms.

  • As a membrane-associated protein, BLi02729/BL01411 might be involved in membrane organization that affects resistance to antimicrobial compounds. Membrane microdomains organized by flotillin-like proteins are known to affect drug efflux systems in some bacteria.

  • Studying how BLi02729/BL01411 functions in B. licheniformis could reveal conserved mechanisms that are potentially present in pathogenic bacteria, providing targets for new antimicrobial strategies.

Methodological approach: Comparative genomics and functional studies across multiple Bacillus species could identify conserved roles of this protein family in antimicrobial production and resistance.

What techniques can be used to study the potential role of BLi02729/BL01411 in bacterial stress response pathways?

To investigate the potential role of BLi02729/BL01411 in bacterial stress response pathways, researchers can employ these methodological approaches:

  • Stress Challenge Experiments: Expose wild-type and BLi02729/BL01411 mutant strains to various stressors (heat, cold, osmotic stress, pH, antibiotics) and compare survival rates and growth dynamics.

  • Transcriptomics: Use RNA-sequencing to compare gene expression profiles between wild-type and mutant strains under normal and stress conditions.

  • Proteomics: Analyze changes in the proteome in response to stress, with particular attention to protein-protein interactions involving BLi02729/BL01411.

  • Protein Localization Studies: Track changes in subcellular localization of fluorescently tagged BLi02729/BL01411 under different stress conditions.

  • Phosphoproteomics: Identify potential phosphorylation or other post-translational modifications of BLi02729/BL01411 during stress responses.

  • Metabolomics: Analyze changes in metabolite profiles that might be associated with altered BLi02729/BL01411 function during stress.

These integrated approaches can provide comprehensive insights into how this protein contributes to bacterial adaptation to environmental challenges.

How can structural studies of BLi02729/BL01411 inform the design of targeted antimicrobial compounds?

Structural studies of BLi02729/BL01411 can inform antimicrobial compound design through several methodological approaches:

  • X-ray Crystallography or Cryo-EM: Determine the three-dimensional structure of the protein to identify potential binding pockets or functional sites.

  • Structure-Based Drug Design: Use the resolved structure to design small molecules that could modulate the protein's function.

  • Fragment-Based Screening: Identify small chemical fragments that bind to the protein and can be developed into larger inhibitors.

  • Molecular Dynamics Simulations: Study the protein's dynamic behavior and identify transiently formed pockets that might not be evident in static structures.

  • Ligand-Binding Assays: Develop high-throughput screening methods to identify compounds that interact with BLi02729/BL01411.

  • Protein-Peptide Interaction Studies: Design peptides that mimic interaction partners to disrupt specific protein functions.

If BLi02729/BL01411 is found to be essential for bacterial survival or virulence, compounds that specifically target this protein could represent a novel class of antimicrobials with potentially reduced off-target effects compared to conventional antibiotics.

How does BLi02729/BL01411 compare to flotillin proteins in other bacterial species?

A comparative analysis of BLi02729/BL01411 with flotillin proteins from other bacterial species reveals important evolutionary and functional insights:

  • Sequence Conservation: Flotillin-like proteins are found across many bacterial species, with varying degrees of sequence conservation. The core domain structure is typically preserved, but specific regulatory regions may differ.

  • Domain Architecture: Most bacterial flotillins contain a characteristic SPFH (Stomatin/Prohibitin/Flotillin/HflK/C) domain and coiled-coil regions. Comparing these domains in BLi02729/BL01411 with other bacterial flotillins can highlight unique features.

  • Membrane Interaction: Different bacterial flotillins may interact with membranes through various mechanisms, including direct transmembrane domains or lipid modifications. Analyzing these differences can provide insights into the specific membrane association mechanism of BLi02729/BL01411.

  • Functional Diversity: In different bacterial species, flotillin-like proteins have been implicated in diverse functions including membrane organization, biofilm formation, signal transduction, and protein secretion. Comparing these roles can suggest potential functions for BLi02729/BL01411.

Methodological approach: Researchers should conduct comprehensive phylogenetic analysis combined with structural modeling to identify conserved and divergent features that might relate to specific functions in B. licheniformis.

What can we learn from comparing experimental approaches used to study similar proteins in model organisms?

Comparative analysis of experimental approaches used to study flotillin-like proteins in model organisms provides valuable methodological insights for BLi02729/BL01411 research:

  • Genetic Manipulation Strategies: Approaches used in model organisms like Bacillus subtilis or Escherichia coli can be adapted for B. licheniformis, considering specific genetic tools available for each organism.

  • Membrane Biology Techniques: Methods developed to study membrane microdomains in model organisms, such as density gradient centrifugation or super-resolution microscopy, can be optimized for B. licheniformis.

  • Protein-Protein Interaction Networks: Systematic approaches used to map interaction networks in model organisms can guide similar efforts for BLi02729/BL01411.

  • Functional Assays: Specialized assays developed to measure specific functions of flotillin-like proteins in other bacteria (e.g., membrane fluidity measurements, lipid raft isolation protocols) can be adapted.

  • Heterologous Expression Systems: Comparing the advantages and limitations of different expression systems used for similar proteins can inform optimal strategies for BLi02729/BL01411 studies.

This comparative approach accelerates research by building on established methods while accounting for the specific biological context of B. licheniformis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.