Recombinant Bacillus licheniformis UPF0756 membrane protein BLi03063/BL00400 (BLi03063, BL00400)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on multiple factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
BLi03063; BL00400; UPF0756 membrane protein BLi03063/BL00400
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)
Target Names
BLi03063
Target Protein Sequence
MFTQANLFLILLLAIALIAKNQSLIIAVSVLLLIKLIGLDQKLFPAIQSKGINWGVTVIT IAVLVPIATGEIGFKQLGEAMKSYYAWIALGAGILVALIAKNGITLLAEDPHITTALVFG TILAVALFKGVAVGPLIGAGIAYLVMQAVQHFTS
Uniprot No.

Target Background

Database Links
Protein Families
UPF0756 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the general characteristics of Bacillus licheniformis as a host for membrane protein expression?

Bacillus licheniformis is a Gram-positive, facultatively anaerobic, motile rod bacterium that belongs to the phylum Bacillota, class Bacilli, and family Bacillaceae. It typically forms round, irregular, whitish colonies of medium size (2-6 mm in diameter) and produces large motile rods (0.6-0.8 x 1.5-3.0 μm) that often appear in chains . B. licheniformis has gained significant attention as an industrial host due to its excellent protein synthesis and secretion capacity, making it particularly suitable for recombinant protein expression .

The organism is mesophilic with a temperature optimum of 30°C but can grow between 15°C and 55°C, offering flexibility in culture conditions . This thermotolerance provides advantages when expressing proteins that might form inclusion bodies at lower temperatures. For membrane protein expression specifically, B. licheniformis offers a Gram-positive cell envelope architecture with a single membrane system, potentially simplifying the extraction and purification process compared to Gram-negative alternatives.

How can researchers confirm the identity and integrity of the expressed BLi03063/BL00400 membrane protein?

Confirming the identity and integrity of the expressed BLi03063/BL00400 membrane protein requires a multi-faceted approach:

  • SDS-PAGE analysis: Separate the protein samples using polyacrylamide gel electrophoresis to confirm the expected molecular weight. For membrane proteins, specialized techniques may be needed as they often display anomalous migration patterns due to their hydrophobic nature .

  • Western blotting: Use antibodies specific to epitope tags (if incorporated) or to the protein itself to verify identity. For multipass membrane proteins like BLi03063/BL00400, special care should be taken during sample preparation to prevent aggregation.

  • Mass spectrometry: Perform peptide mass fingerprinting or tandem mass spectrometry to confirm the protein sequence. This approach is particularly valuable for uncharacterized proteins to verify the translated sequence matches the predicted gene product.

  • Freeze-fracture electron microscopy: This technique can reveal the presence and distribution of intramembrane particles similar to how band 3 protein can be visualized in red blood cell membranes . The fracture plane tends to pass through the hydrophobic middle of membrane lipid bilayers, exposing intramembrane proteins that can be visualized after platinum shadowing.

  • Functional assays: Design assays based on predicted functions (if available) to verify that the protein retains its biological activity after expression and purification.

What genetic modification strategies are most effective for expressing the BLi03063/BL00400 membrane protein in B. licheniformis?

For efficient expression of the BLi03063/BL00400 membrane protein in B. licheniformis, a chromosomal integration strategy is recommended over plasmid-based expression, particularly for long-term stability. The high-efficiency chromosomal integrative amplification strategy developed for B. licheniformis offers a powerful approach:

  • Helper plasmid system: Utilize a dual plasmid system consisting of a thermosensitive helper plasmid (e.g., pUB-MazF) and an integrative expression plasmid (e.g., pUB'-EX1) . The helper plasmid provides replication functions for the integrative plasmid while also carrying the MazF endoribonuclease gene that facilitates plasmid curing.

  • Multiple copy integration: By using selection pressure (such as kanamycin) and elevated temperatures in the presence of an inducer like IPTG, researchers can achieve multiple copy integration of the target gene into the chromosome . This approach has been shown to significantly increase protein yields compared to single-copy integration.

  • Promoter selection: For membrane proteins, which can be toxic when overexpressed, consider using tightly regulated promoters. The IPTG-inducible promoter system described in the pUB-MazF/pUB'-EX1 system allows for controlled expression .

  • Integration site selection: Target integration to non-essential regions of the chromosome or to sites that might enhance expression. The 3'-amyL' site has been successfully used for heterologous protein expression in B. licheniformis .

This chromosomal integration strategy has demonstrated "perfect genetic stability" in industrial enzyme production with B. licheniformis, making it particularly suitable for long-term expression of membrane proteins that might otherwise impose a metabolic burden on the host .

What are the optimal methods for extracting and purifying the BLi03063/BL00400 membrane protein while maintaining its native conformation?

Extracting and purifying membrane proteins while preserving their native conformation presents significant challenges due to their amphipathic nature. For the BLi03063/BL00400 protein, consider the following methodological approach:

  • Membrane isolation:

    • Harvest B. licheniformis cells expressing the target protein by centrifugation

    • Disrupt cells using methods that minimize heat generation (French press or sonication with cooling)

    • Separate membranes by ultracentrifugation through a sucrose gradient

    • Wash membranes to remove peripheral proteins while retaining integral membrane proteins

  • Detergent solubilization:

    • Select appropriate detergents based on protein characteristics (e.g., mild non-ionic detergents like DDM or LMNG for initial trials)

    • Optimize detergent concentration, solubilization time, and temperature

    • Verify solubilization efficiency by monitoring protein in the supernatant after ultracentrifugation

  • Affinity purification:

    • Incorporate affinity tags (His-tag, FLAG-tag) at termini predicted to be exposed to the aqueous environment

    • Use detergent-compatible resins and buffers during chromatography

    • Include appropriate protease inhibitors to prevent degradation

  • Assessing protein quality:

    • Analyze oligomeric state using size exclusion chromatography

    • Verify folding using circular dichroism or fluorescence spectroscopy

    • Assess functionality through specific activity assays

  • Reconstitution:

    • For functional studies, reconstitute the purified protein into liposomes or nanodiscs

    • Verify orientation in the reconstituted system through protease accessibility assays

Membrane proteins are notoriously difficult to solubilize while maintaining their native structure. The purification process should be monitored at each step to ensure that the protein remains stable and retains its structural integrity .

What are the advantages and limitations of using electron crystallography versus X-ray crystallography for determining the structure of BLi03063/BL00400?

Both electron crystallography and X-ray crystallography offer distinct advantages and limitations for determining the structure of membrane proteins like BLi03063/BL00400:

Electron Crystallography:

Advantages:

  • Requires two-dimensional crystals, which are often easier to obtain for membrane proteins than three-dimensional crystals

  • Can provide high-resolution structural data (up to 3Å) while the protein remains in a lipid environment, maintaining a more native-like state

  • Particularly suitable for proteins that naturally form ordered arrays in membranes

  • Requires less material than X-ray crystallography

  • Has been successfully used for membrane proteins like bacteriorhodopsin

Limitations:

  • Resolution often lower than the best X-ray structures

  • Sample preparation is technically demanding

  • Data collection and processing require specialized expertise

  • Limited to relatively stable proteins that can withstand electron beam damage

X-ray Crystallography:

Advantages:

  • Can achieve very high resolution (potentially sub-2Å)

  • Well-established methodology with robust data processing pipelines

  • Can handle larger and more complex protein structures

  • Provides clear electron density maps for bound ligands or cofactors

Limitations:

  • Requires three-dimensional crystals, which are notoriously difficult to obtain for membrane proteins

  • Often requires detergent solubilization which may perturb native structure

  • Usually requires large amounts of highly pure, homogeneous protein

  • May capture non-physiological conformations due to crystal packing forces

For BLi03063/BL00400, the choice between these methods would depend on factors including the stability of the protein, its tendency to form ordered arrays, and the specific structural questions being addressed. A hybrid approach combining multiple structural techniques might provide the most comprehensive understanding of this uncharacterized membrane protein .

How can researchers determine the membrane topology and orientation of the BLi03063/BL00400 protein?

Determining the membrane topology and orientation of the BLi03063/BL00400 protein requires a combination of computational prediction and experimental validation:

  • Computational predictions:

    • Hydropathy analysis to identify potential transmembrane segments

    • Topology prediction algorithms (TMHMM, TOPCONS) to predict the number and orientation of transmembrane helices

    • Analysis of the positive-inside rule, which suggests cytoplasmic loops often contain more positively charged residues

  • Experimental approaches:

    • Substituted cysteine accessibility method (SCAM): Introduce cysteine residues at predicted loops/termini and test their accessibility to membrane-impermeable sulfhydryl reagents

    • Protease protection assays: Expose sealed membrane vesicles to proteases and identify protected fragments by mass spectrometry

    • Fluorescence quenching: Attach fluorophores to specific sites and measure quenching by membrane-impermeable quenchers

    • Glycosylation mapping: Introduce glycosylation sites at various positions - only sites exposed to the ER lumen will be glycosylated in eukaryotic expression systems

  • Reporter fusion approach:

    • Create fusion proteins with reporter domains (GFP, alkaline phosphatase, β-lactamase)

    • The activity/fluorescence of these reporters depends on their cellular localization

    • Systematic analysis of different fusion positions can map the entire topology

  • Antibody accessibility:

    • Generate antibodies against specific epitopes or use epitope tags

    • Test accessibility in intact cells, permeabilized cells, and inside-out membrane vesicles

  • Freeze-fracture electron microscopy:

    • This technique can reveal which leaflet of the membrane contains the bulk of the protein mass, similar to how band 3 protein is visualized in red blood cell membranes

For multipass membrane proteins, like many UPF family proteins, combining multiple approaches provides the most reliable topology model. The gold standard remains high-resolution structural determination through X-ray crystallography, cryo-electron microscopy, or electron crystallography .

What experimental approaches are most effective for determining the function of uncharacterized membrane proteins like BLi03063/BL00400?

Determining the function of uncharacterized membrane proteins like BLi03063/BL00400 requires a systematic multi-faceted approach:

  • Bioinformatic analysis:

    • Sequence similarity searches against characterized proteins

    • Identification of conserved domains or motifs

    • Evolutionary analysis to identify orthologs in other species

    • Context-based methods examining genomic neighborhood and co-occurrence patterns

  • Gene knockout/knockdown studies:

    • Generate knockout strains using the chromosomal integration system described for B. licheniformis

    • Perform comprehensive phenotypic characterization under various growth conditions

    • Compare transcriptomes or proteomes between wild-type and knockout strains

    • Test sensitivity to various stressors (osmotic, pH, temperature, antibiotics)

  • Protein interaction studies:

    • Pull-down assays using tagged versions of BLi03063/BL00400

    • Crosslinking coupled with mass spectrometry to identify neighboring proteins

    • Bacterial two-hybrid or split-GFP complementation assays

    • Co-purification experiments to identify stable interaction partners

  • Transport assays (if suspected to be a transporter):

    • Reconstitute purified protein into liposomes loaded with fluorescent indicators

    • Measure uptake/efflux of radioactively labeled substrates

    • Perform electrophysiological measurements if ion transport is suspected

    • Design high-throughput substrate screening assays

  • Structural studies:

    • Identify potential ligand binding sites from structural data

    • Perform in silico docking studies with potential substrates

    • Use structure-guided mutagenesis to test functional hypotheses

  • Localization studies:

    • Determine subcellular localization using fluorescent protein fusions

    • Investigate whether the protein localizes to specific membrane domains

    • Examine changes in localization under different growth conditions

By combining these approaches, researchers can develop and test hypotheses about the function of BLi03063/BL00400, even without initial functional leads. The multi-faceted approach helps overcome limitations of individual methods and provides convergent evidence for functional assignments.

How can researchers design assays to test if BLi03063/BL00400 functions as an anion transporter similar to the band 3 protein in red blood cells?

To investigate whether BLi03063/BL00400 functions as an anion transporter similar to the band 3 protein, researchers should implement a systematic testing approach:

  • Liposome-based transport assays:

    • Reconstitute purified BLi03063/BL00400 into liposomes

    • Load liposomes with pH-sensitive or anion-sensitive fluorescent dyes

    • Monitor fluorescence changes upon addition of potential substrates like bicarbonate (HCO₃⁻) or chloride (Cl⁻)

    • Compare transport rates and substrate specificity with known anion transporters

    • Test for hallmark characteristics of band 3-like transporters, such as anion exchange (HCO₃⁻/Cl⁻) rather than simple channel activity

  • Inhibitor studies:

    • Test sensitivity to known anion transport inhibitors (e.g., DIDS, SITS)

    • Perform dose-response analyses to determine inhibition constants

    • Compare inhibition profiles with established anion transporters

  • Electrophysiological measurements:

    • Incorporate the protein into planar lipid bilayers or giant liposomes

    • Use patch-clamp techniques to measure ion conductance

    • Determine ion selectivity by changing ion compositions

    • Characterize the voltage dependence of transport activity

  • In vivo complementation studies:

    • Express BLi03063/BL00400 in bacterial or yeast strains deficient in anion transport

    • Assess whether expression restores growth under conditions requiring anion exchange

    • Create chimeric proteins with functional domains from known anion transporters

  • Structure-function analysis:

    • Identify potential anion binding sites through structural analysis or modeling

    • Perform site-directed mutagenesis of key residues

    • Test mutants for altered transport activity or substrate specificity

    • Compare with equivalent mutations in well-characterized anion transporters like band 3

  • Kinetic analysis:

    • Determine transport kinetics (Km, Vmax) for different anions

    • Test for competitive, non-competitive, or uncompetitive inhibition patterns

    • Examine pH dependence of transport activity

    • Investigate the temperature dependence to calculate activation energies

When designing these assays, researchers should consider that unlike red blood cells where band 3 functions primarily in gas transport, B. licheniformis as a soil bacterium may utilize anion transport for different physiological purposes, possibly related to pH homeostasis or resistance to environmental stresses .

How might the development of high-copy chromosomal integration systems in B. licheniformis impact the study of BLi03063/BL00400 and other membrane proteins?

The development of high-copy chromosomal integration systems in B. licheniformis represents a significant advancement with several important implications for membrane protein research:

  • Enhanced expression levels:

    • Multiple copy integration can significantly increase protein yield, addressing a common challenge in membrane protein research

    • The pUB-MazF/pUB'-EX1 system allows for controlled integration of multiple gene copies, with some recombinants showing 22-fold improvement in protein production

    • Higher expression levels facilitate structural studies that require substantial amounts of purified protein

  • Improved genetic stability:

    • Chromosomal integration eliminates issues associated with plasmid loss during long-term cultivation

    • The genetic stability has been verified through repeated subculturing and fermentation studies

    • Stable expression is particularly valuable for industrial-scale production or long-term experiments

  • Reduced metabolic burden:

    • Compared to high-copy plasmids, chromosomal integration often results in lower metabolic burden

    • This is especially important for membrane proteins like BLi03063/BL00400 that may be toxic when overexpressed

    • The reduced stress on cells may lead to better folding and incorporation of membrane proteins

  • Precise control of gene dosage:

    • The ability to select recombinants with varying copy numbers allows optimization of expression levels

    • Researchers can balance protein yield against potential toxicity or misfolding

    • Different copy numbers can be used to study dose-dependent effects on cellular physiology

  • Scalability for industrial applications:

    • The demonstrated success in 50-liter bioreactors suggests feasibility for large-scale production

    • This enables structural studies requiring large amounts of protein or functional studies requiring substantial quantities of purified material

  • Platform for systematic studies:

    • The system facilitates the creation of strain libraries expressing variants of BLi03063/BL00400

    • Multiple variants can be stably maintained for comparative functional or structural studies

    • Enables comprehensive mutagenesis studies to map functional domains

The high-efficiency chromosomal integrative amplification strategy with the MazF counter-selection system represents a significant technological advancement that could accelerate research on membrane proteins like BLi03063/BL00400 by addressing many of the traditional challenges in membrane protein expression and purification .

What are the most promising approaches for resolving potential data conflicts in the structural characterization of BLi03063/BL00400?

Resolving data conflicts in the structural characterization of membrane proteins like BLi03063/BL00400 requires a systematic approach combining multiple techniques and critical analysis:

  • Integrative structural biology approach:

    • Combine data from multiple structural methods (X-ray crystallography, cryo-EM, NMR, SAXS)

    • Each technique has different strengths and limitations; together they provide complementary information

    • Use computational methods to generate models that satisfy constraints from all experimental data

    • Assign confidence levels to different structural elements based on convergence across methods

  • Environmental considerations:

    • Compare structures determined in different environments (detergent micelles, nanodiscs, liposomes)

    • Assess whether discrepancies reflect genuine conformational flexibility or experimental artifacts

    • Examine the impact of lipid composition on structural features

    • Consider native-like membrane mimetics for validation studies

  • Functional validation of structural models:

    • Design mutagenesis experiments targeting key structural features with conflicting data

    • Test functional consequences of mutations to discriminate between alternative structural models

    • Use cross-linking studies to validate proximity relationships predicted by different models

    • Employ molecular dynamics simulations to test stability of proposed structures

  • Resolution of detergent artifacts:

    • Membrane proteins like BLi03063/BL00400 may adopt non-native conformations in detergents

    • Compare structures from detergent-solubilized protein with those from native membrane-like environments

    • Consider the use of electron crystallography, which studies proteins in a lipid bilayer environment

    • Evaluate potential crystal packing artifacts in X-ray structures

  • Conformational ensemble approach:

    • Recognize that membrane proteins often exist in multiple conformational states

    • Apparent conflicts may represent different functional states rather than experimental errors

    • Use techniques like DEER spectroscopy to map conformational distributions

    • Develop computational models that incorporate conformational heterogeneity

  • Collaborative validation:

    • Engage multiple laboratories to independently reproduce key structural findings

    • Establish consistent protocols for protein preparation and structural analysis

    • Share raw data to enable direct comparison of primary results

    • Publish comprehensive methodological details to facilitate reproduction

By systematically addressing potential sources of conflict and integrating multiple lines of evidence, researchers can develop robust structural models of BLi03063/BL00400 that provide a foundation for mechanistic studies and function prediction .

What are the optimal detergent conditions for solubilizing and purifying BLi03063/BL00400 while maintaining its native structure?

Determining optimal detergent conditions for membrane proteins like BLi03063/BL00400 requires systematic optimization and evaluation:

  • Initial detergent screening:

    • Test a panel of detergents representing different chemical classes:

      • Mild non-ionic detergents (DDM, LMNG, Digitonin)

      • Zwitterionic detergents (LDAO, FC-12, CHAPSO)

      • Steroid-based detergents (Cholate, Deoxycholate)

    • Evaluate extraction efficiency by quantifying protein in the soluble fraction

    • Assess protein stability using size-exclusion chromatography

    • Monitor monodispersity using dynamic light scattering

  • Optimization of solubilization conditions:

    • Titrate detergent concentration (typically 1-10× critical micelle concentration)

    • Test different solubilization temperatures (4°C, room temperature)

    • Optimize solubilization time (1 hour to overnight)

    • Evaluate the impact of additives (glycerol, specific lipids, stabilizing ligands)

  • Detergent exchange during purification:

    • Consider switching to a milder detergent after initial extraction

    • Evaluate protein stability in different detergents during prolonged storage

    • Test the impact of detergent concentration on protein stability and activity

    • Consider mixed micelle systems (detergent + lipid or detergent combinations)

  • Quality assessment methods:

    • Thermal stability assays (DSF, nanoDSF) to compare stabilizing effects

    • Circular dichroism to monitor secondary structure integrity

    • Tryptophan fluorescence to assess tertiary structure

    • Activity assays to confirm functional integrity

  • Alternative solubilization strategies:

    • Styrene maleic acid lipid particles (SMALPs) for detergent-free extraction

    • Amphipols for improved stability after initial detergent extraction

    • Nanodiscs for reconstitution into a more native-like environment

    • Saposin-lipoprotein nanoparticles for maintaining native lipid interactions

Membrane proteins are notoriously sensitive to their environment, and conditions must be optimized specifically for each protein. For BLi03063/BL00400, researchers should systematically test multiple conditions and evaluate not just solubilization efficiency but also structural integrity and functional activity to identify truly optimal conditions .

How should researchers design targeted mutagenesis experiments to elucidate the structure-function relationship of BLi03063/BL00400?

Designing effective mutagenesis experiments for elucidating structure-function relationships in BLi03063/BL00400 requires a strategic approach:

  • Rational mutagenesis based on sequence analysis:

    • Identify conserved residues through multiple sequence alignments with homologs

    • Target residues unique to subfamilies that might determine specific functions

    • Focus on charged or polar residues within predicted transmembrane regions, which often play crucial roles in membrane proteins

    • Create systematic alanine scanning libraries of selected protein regions

  • Structure-guided mutagenesis:

    • If structural data is available, target residues in potential binding sites or catalytic regions

    • Examine predicted transmembrane topology to identify residues at membrane interfaces

    • Focus on residues in predicted pore regions if a transport function is hypothesized

    • Create mutations that alter predicted structural features (e.g., helix-breaking mutations)

  • Functional domain mapping:

    • Generate truncation variants to identify essential functional domains

    • Create chimeric proteins by swapping domains with related proteins of known function

    • Use insertion mutagenesis to identify regions tolerant to modification

    • Design mutations that might alter oligomerization if multimeric assembly is suspected

  • Experimental design considerations:

    • Include appropriate controls (wild-type, catalytically inactive mutants)

    • Create multiple mutation types at key positions (conservative vs. non-conservative)

    • Consider synergistic effects through double or triple mutations

    • Use site-saturation mutagenesis at critical positions to comprehensively explore amino acid preferences

  • Expression and functional analysis:

    • Verify proper expression and membrane localization of mutants

    • Develop quantitative assays to measure functional changes

    • Consider both gain-of-function and loss-of-function outcomes

    • Examine potential structural changes using biophysical techniques

  • Integration with the B. licheniformis expression system:

    • Utilize the high-efficiency chromosomal integration system for stable expression of mutants

    • Consider creating libraries of mutants for high-throughput screening

    • Use the MazF counter-selection system to ensure plasmid curing and chromosomal integration

    • Design mutants that can be tested in both in vitro and in vivo systems

Effective mutagenesis studies should test specific hypotheses about BLi03063/BL00400 function while also allowing for unexpected discoveries. The combination of rational design with systematic approaches maximizes the chances of gaining meaningful insights into structure-function relationships.

How might systems biology approaches contribute to understanding the physiological role of BLi03063/BL00400 in B. licheniformis?

Systems biology approaches offer powerful strategies for uncovering the physiological role of uncharacterized membrane proteins like BLi03063/BL00400:

  • Transcriptomic profiling:

    • Compare gene expression patterns between wild-type and BLi03063/BL00400 knockout strains

    • Analyze expression changes under various growth conditions (temperature, pH, nutrient limitation)

    • Identify co-regulated genes that may function in the same pathway

    • Use time-course experiments to capture dynamic responses to environmental perturbations

  • Proteomic analysis:

    • Conduct quantitative proteomics to identify protein abundance changes in knockout strains

    • Use membrane proteomics to identify changes in membrane protein composition

    • Perform post-translational modification analysis to identify regulatory mechanisms

    • Couple with protein interaction studies to map the protein's position in cellular networks

  • Metabolomic investigations:

    • Profile metabolite changes in knockout strains to identify affected pathways

    • Conduct flux analysis using isotope-labeled substrates

    • Focus on membrane-associated metabolites that might be substrates

    • Correlate metabolic changes with phenotypic observations

  • Integrative network analysis:

    • Construct gene regulatory networks incorporating transcriptomic data

    • Build protein-protein interaction networks from proteomics and interaction studies

    • Develop metabolic models that integrate metabolomic data

    • Identify network motifs and modules affected by BLi03063/BL00400 perturbation

  • Comparative genomics approach:

    • Analyze the genomic context of BLi03063/BL00400 across different bacterial species

    • Identify conserved gene neighborhoods that suggest functional relationships

    • Correlate presence/absence patterns with specific phenotypes or environmental adaptations

    • Examine evolutionary patterns to infer functional constraints

  • Phenotypic profiling:

    • Perform high-throughput phenotypic screens under diverse conditions

    • Use phenotype microarrays to test growth on hundreds of substrates

    • Measure competitive fitness in mixed cultures

    • Quantify stress responses and adaptations in B. licheniformis strains with varying BLi03063/BL00400 expression levels

By integrating data from these complementary approaches, researchers can develop testable hypotheses about the physiological role of BLi03063/BL00400 in B. licheniformis, particularly in contexts relevant to its natural soil habitat or industrial applications .

What are the most promising applications of structural data on BLi03063/BL00400 for biotechnology and synthetic biology?

Structural data on membrane proteins like BLi03063/BL00400 can drive numerous biotechnological and synthetic biology applications:

  • Engineered transport systems:

    • Modify substrate specificity to create tailored transport systems

    • Develop sensors for specific molecules based on transport-coupled signaling

    • Create controllable channels or transporters responsive to external stimuli

    • Design membrane protein-based filtration or separation technologies

  • Protein engineering platforms:

    • Use the structural scaffold to design novel membrane protein functions

    • Create chimeric proteins with domains from different membrane proteins

    • Develop stable expression platforms for other challenging membrane proteins

    • Design membrane protein switches for synthetic biology circuits

  • Drug discovery applications:

    • If BLi03063/BL00400 has homologs in pathogens, use structural data for inhibitor design

    • Develop screening systems for compounds that modulate membrane protein function

    • Create expression systems for producing membrane protein targets for drug screening

    • Design peptide mimetics that interact with specific membrane protein domains

  • Biosensor development:

    • Engineer ligand-binding domains for detecting specific compounds

    • Couple transport activity to reporter systems for real-time monitoring

    • Develop whole-cell biosensors with modified membrane protein components

    • Create membrane protein-based electrochemical sensing elements

  • Industrial biotechnology applications:

    • Enhance B. licheniformis as an expression host by optimizing membrane protein biogenesis

    • Improve protein secretion by engineering membrane translocation systems

    • Develop strains with modified membrane permeability for bioprocess applications

    • Use the high-efficiency chromosomal integration system to create stable production strains

  • Synthetic membrane systems:

    • Incorporate engineered versions into artificial cell systems

    • Develop biomimetic membranes for separation technologies

    • Create nanoreactors with controlled permeability

    • Design responsive materials based on membrane protein conformational changes

The high-efficiency chromosomal integrative amplification strategy developed for B. licheniformis provides an excellent platform for implementing these applications, as it enables stable, high-level expression of membrane proteins and has been demonstrated in industrial-scale bioreactors . The genetic stability of recombinants developed using this system makes it particularly valuable for long-term industrial applications requiring consistent protein production.

What strategies can researchers employ to overcome inclusion body formation when expressing BLi03063/BL00400?

Inclusion body formation is a common challenge when expressing membrane proteins like BLi03063/BL00400. The following strategies can help researchers overcome this issue:

  • Optimization of expression conditions:

    • Reduce expression temperature (20-25°C) to slow protein synthesis and allow proper folding

    • Use weaker promoters or lower inducer concentrations for more controlled expression

    • Test different growth media compositions, particularly those that support membrane biogenesis

    • Consider expression during different growth phases (early versus late exponential)

  • Genetic strategies:

    • Utilize the thermosensitive expression system for tight control over expression timing

    • Co-express molecular chaperones specific to membrane proteins

    • Consider fusion tags that enhance solubility (e.g., MBP, SUMO) with careful placement

    • Express with native signal sequences if applicable

  • Host strain engineering:

    • Use B. licheniformis strains with enhanced membrane protein handling capacity

    • Consider knockout strains with reduced proteolytic activity

    • Engineer strains with altered membrane composition to accommodate the target protein

    • Utilize the chromosomal integration system to control gene dosage precisely

  • Protein engineering approaches:

    • Identify and modify aggregation-prone regions through computational prediction

    • Create truncated constructs focusing on specific domains

    • Test expression of individual transmembrane segments

    • Introduce stabilizing mutations based on homology modeling

  • Solubilization and refolding strategies:

    • Develop protocols for efficiently extracting proteins from inclusion bodies

    • Optimize refolding conditions using a systematic screen of detergents and lipids

    • Employ gradual dialysis methods for controlled refolding

    • Use artificial chaperones to assist refolding process

  • Alternative expression systems:

    • Compare expression in different Bacillus species

    • Consider cell-free expression systems coupled with immediate detergent solubilization

    • Test eukaryotic expression systems for complex membrane proteins

    • Evaluate the use of specialized membrane protein expression strains

The chromosomal integration system developed for B. licheniformis offers particular advantages for membrane protein expression, as it allows for stable, controlled expression levels that can be optimized to balance between sufficient yield and minimal inclusion body formation .

How can researchers address challenges in distinguishing between structural changes caused by detergent solubilization versus intrinsic conformational changes of BLi03063/BL00400?

Distinguishing between detergent-induced structural changes and intrinsic conformational dynamics of membrane proteins like BLi03063/BL00400 requires a multi-faceted approach:

  • Comparative analysis across multiple detergents:

    • Compare protein behavior in detergents of different classes (non-ionic, zwitterionic, ionic)

    • Analyze structural parameters across a concentration series of the same detergent

    • Use size-exclusion chromatography to assess oligomeric state in different detergents

    • Compare activity/function across different detergent environments

  • Native-like membrane mimetics:

    • Compare structures in detergent micelles versus more native-like systems:

      • Nanodiscs with controlled lipid composition

      • Styrene maleic acid lipid particles (SMALPs) that extract membrane patches

      • Amphipols that stabilize membrane proteins with minimal detergent

      • Liposomes of defined composition

    • Correlate structural changes with functional measurements in each system

  • Spectroscopic approaches:

    • Use circular dichroism to monitor secondary structure across conditions

    • Apply fluorescence spectroscopy to assess tertiary structure changes

    • Employ FTIR spectroscopy to examine hydrogen bonding networks

    • Utilize EPR spectroscopy with site-directed spin labeling to measure distances between specific residues

  • Dynamics measurements:

    • Conduct hydrogen-deuterium exchange mass spectrometry in different environments

    • Use NMR relaxation measurements to identify mobile regions

    • Apply single-molecule FRET to capture conformational distributions

    • Perform limited proteolysis to identify flexible or exposed regions

  • Computational approaches:

    • Conduct molecular dynamics simulations in explicit detergent micelles versus lipid bilayers

    • Use enhanced sampling methods to explore the conformational landscape

    • Perform computational detergent screening to identify minimal-perturbation conditions

    • Model detergent binding sites to identify potential structure-perturbing interactions

  • Structure validation techniques:

    • Apply electron crystallography, which allows structure determination in lipid bilayers

    • Use cross-linking coupled with mass spectrometry to validate distance constraints

    • Employ solid-state NMR on reconstituted samples

    • Validate key structural features through targeted mutagenesis and functional studies

By systematically comparing structural and functional properties across these different experimental conditions, researchers can build a comprehensive understanding of which features represent intrinsic properties of BLi03063/BL00400 versus artifacts of the solubilization and purification process .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.