Recombinant Bacillus megaterium Putative stage IV sporulation protein (spoIV)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Shipping defaults to blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
spoIV; BMD_4540; Putative stage IV sporulation protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-395
Protein Length
full length protein
Species
Bacillus megaterium (strain DSM 319)
Target Names
spoIV
Target Protein Sequence
MKNGWTNFVIGTVRIRIVGKGIERFLNNCVRQQIMISNVHKVDGQLATATILLKDVKKIR ILIRNADCKIYFIRGRGFPFLTKRVIKNSGFALGFLSFFIILGLLSNMVWKVEISGAEPQ TEHQMTKQLAKIGVKRGEFQFLLESPEKIQRYLTDNMNNITWVGVEVRGTSYHFQVVEKN EPKPQQKTPYQHLIAKKKAIITNLFVEKGQPLVKVNDFVNEGEVLVSGIIGNEKNKKVVA AKGKVYGETWYKSEVEVPLKTDFQVLTGNGYTKHYLDFQAFKMPLWAFNKEKYTSKVTEK VEHPLYFFKWKLPLSYEKVAVREEQNSQRVYSKQEAVEKALEIGRKKLLSTLGEDAKIKG EKVLHQEQDNGKVRLSIHYQVIENIANTQPIIQGD
Uniprot No.

Target Background

Function

This protein may play a role in the completion of stage IV during sporulation.

Database Links

KEGG: bmd:BMD_4540

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the biological role of SpoIV protein in Bacillus megaterium sporulation?

SpoIV protein plays a critical role in the later stages of bacterial sporulation, specifically during stage IV of the process. Based on research into sporulation proteins in Bacillus species, SpoIV is likely involved in signaling pathways that regulate the progression of spore development after asymmetric cell division and engulfment have occurred . The protein appears to be functionally related to other sporulation proteins like SpoIVFB which is involved in pro-σK processing in the mother cell compartment during sporulation . While SpoIVFB has been characterized as containing an HEXXH motif characteristic of metalloproteases, the exact enzymatic activity of SpoIV in B. megaterium requires further characterization. Researchers should note that sporulation proteins often exhibit compartment-specific activities that coordinate development between the mother cell and forespore .

How can researchers effectively express recombinant SpoIV protein?

To express recombinant Bacillus megaterium putative stage IV sporulation protein (SpoIV), researchers should consider using specialized expression systems optimized for Bacillus-derived proteins. E. coli-based expression systems have limitations when expressing Bacillus spore proteins due to potential toxicity and improper folding. A more effective approach involves using B. subtilis or B. megaterium itself as expression hosts, as these maintain the native cellular environment for proper protein folding and modification. Expression vectors containing strong, inducible promoters like the Pspac promoter have proven successful for sporulation proteins . This promoter system allows for isopropyl-β-D-thiogalactopyranoside (IPTG) induction, providing tight regulation of expression timing. When designing expression constructs, researchers should include purification tags that don't interfere with protein function, ideally positioned at the C-terminus to minimize disruption of targeting sequences often found at the N-terminus of sporulation proteins .

What analytical methods are most suitable for characterizing purified SpoIV protein?

For comprehensive characterization of recombinant SpoIV protein, researchers should employ multiple complementary analytical techniques. Begin with SDS-PAGE to assess purity and molecular weight, followed by Western blotting using specific antibodies to confirm identity. For structural analysis, circular dichroism spectroscopy provides insights into secondary structure elements, while analytical ultracentrifugation can determine the oligomeric state - particularly important since some sporulation proteins like the B. megaterium spore protease function as tetramers . Mass spectrometry should be used for accurate molecular weight determination and identification of post-translational modifications. For functional characterization, develop activity assays based on known or predicted enzymatic functions, potentially including protease activity assays if SpoIV shares functional similarities with other sporulation proteases. Finally, interaction studies using pull-down assays or surface plasmon resonance can identify binding partners within the sporulation machinery .

How do mutations in conserved motifs affect SpoIV protein function?

Based on research with related sporulation proteins, mutations in conserved motifs of SpoIV likely have significant functional consequences. Studies of SpoIVFB have demonstrated that the HEXXH motif, characteristic of metalloproteases, is critical for function . Conservative substitutions within this motif (particularly the histidine and second glutamic acid residues) abolish function, while certain substitutions like changing glutamic acid to aspartic acid are tolerated . Researchers investigating SpoIV should conduct similar systematic mutagenesis targeting conserved regions. Another conserved region containing the DG sequence (called region C or the NPDG motif) may also be functionally important, as mutations in this region in SpoIVFB (specifically D137) significantly impact function . When designing mutagenesis experiments for SpoIV, researchers should:

  • Identify all conserved motifs through sequence alignment with homologous proteins

  • Create a panel of mutations ranging from conservative to non-conservative substitutions

  • Assess effects on protein stability, localization, and function in vivo

  • Evaluate the impact on sporulation efficiency through quantitative sporulation assays

These studies would provide valuable insights into structure-function relationships of SpoIV and its mechanistic role in sporulation .

What is the relationship between SpoIV and the broader sporulation transcriptome?

The relationship between SpoIV and the broader sporulation transcriptome is likely complex and multifaceted, similar to what has been observed with other sporulation proteins. Research on SpoIIE mutants has revealed that disruption of a single sporulation protein can have widespread effects on gene expression . When investigating SpoIV's impact on the transcriptome, researchers should conduct RNA-seq analysis comparing wild-type and spoIV mutant strains at multiple time points during sporulation. Based on findings from spoIIE studies, we would expect that SpoIV disruption affects expression of numerous genes beyond those directly involved in sporulation . In spoIIE mutants, 243 genes showed significant differential expression, with 97% being down-regulated and 45% encoding proteins of unknown function . Notably, genes involved in stress response, cell wall formation, signal transduction, and metabolism were affected. For SpoIV, researchers should pay particular attention to:

  • Temporal patterns of gene expression changes

  • Identification of potential direct versus indirect effects

  • Changes in expression of stress-response genes

  • Effects on genes involved in specific sporulation stages

This transcriptomic approach would help elucidate SpoIV's role as both a target and effector in sporulation regulatory networks .

How does SpoIV protein localize during different stages of sporulation?

Understanding the dynamic localization of SpoIV during sporulation requires sophisticated imaging techniques combined with careful timing of sporulation stages. Based on research on other sporulation proteins, SpoIV likely exhibits stage-specific localization patterns essential to its function . To investigate this:

  • Generate fluorescent protein fusions (preferably with mNeonGreen or mScarlet due to their brightness and photostability) at either terminus of SpoIV, with flexible linkers to minimize functional disruption

  • Verify that fusion proteins retain function through complementation assays in spoIV deletion strains

  • Use time-lapse fluorescence microscopy to track protein localization throughout the sporulation process

  • Employ super-resolution techniques like STORM or PALM for detailed sub-cellular localization

  • Co-visualize with membrane stains and other sporulation protein markers to establish spatial relationships

Research on other sporulation proteins suggests that SpoIV may localize to specific regions such as the forespore membrane or mother cell-forespore interface . The spore protease in B. megaterium, for example, appears early in sporulation within the developing forespore . Similar compartmentalization may be critical for SpoIV function, potentially restricting its activity to specific cellular locations during specific developmental windows .

What are the optimal conditions for studying SpoIV protein activity in vitro?

Establishing optimal conditions for in vitro SpoIV activity assays requires systematic evaluation of multiple parameters. Based on studies of similar sporulation proteins, researchers should consider:

ParameterRange to TestConsiderations
pH6.0 - 8.5Test at 0.5 pH unit increments
Temperature25°C - 45°CInclude physiological temperature (37°C)
Divalent CationsMg²⁺, Mn²⁺, Ca²⁺, Zn²⁺Test concentrations from 1-10 mM
Ionic Strength50-300 mM NaClMay affect protein-protein interactions
Reducing AgentsDTT, β-mercaptoethanolImportant if disulfide bonds are present
DetergentsMild non-ionic (if membrane-associated)Test CHAPS, DDM, or Triton X-100 at concentrations below CMC

If SpoIV functions as a protease like some other sporulation proteins, appropriate substrates must be identified . Researchers should test both synthetic peptide substrates and native Bacillus proteins found in the sporulation pathway. Activity assays should incorporate appropriate positive controls (known sporulation proteases) and negative controls (heat-inactivated enzyme, active site mutants). A critical consideration is that SpoIV may require interaction partners or specific lipid environments for activity, particularly if it normally functions in a membrane-associated complex like SpoIVFB .

How can researchers develop effective gene knockout and complementation systems for studying SpoIV?

Developing robust genetic systems for studying SpoIV function requires careful design of knockout constructs and complementation vectors. Based on successful approaches with other sporulation genes:

  • For gene knockouts, design homologous recombination cassettes with at least 500 bp of homology flanking the spoIV gene

  • Use markerless deletion systems to avoid polar effects on downstream genes in the same operon

  • Confirm deletions through both PCR verification and sequencing

  • Phenotypically characterize the knockout by quantitative sporulation assays and electron microscopy to observe morphological defects

For complementation:

  • Create an expression vector with the native spoIV promoter or an inducible system like the Pspac promoter used successfully with spoIVFB

  • Include various forms of the gene: wild-type, tagged versions, and site-directed mutants

  • Ensure proper expression timing to match the natural sporulation program

  • Quantify protein expression levels to ensure physiologically relevant complementation

This system allows researchers to perform structure-function analyses through complementation with mutant versions of SpoIV. When using inducible promoters, researchers should carefully titrate inducer concentrations to achieve near-physiological expression levels, as overexpression of sporulation proteins can lead to artifactual results .

What approaches can detect and quantify protein-protein interactions involving SpoIV during sporulation?

Studying protein-protein interactions of SpoIV during sporulation requires methods compatible with the complex, temporal nature of the sporulation process. Based on successful approaches with other sporulation proteins, researchers should employ multiple complementary techniques:

  • In vivo crosslinking followed by co-immunoprecipitation: Use cell-permeable crosslinkers with various spacer arm lengths to capture transient interactions. This approach has been successful for identifying interaction partners of spore proteases .

  • Bacterial two-hybrid systems: Particularly suitable for initial screening of potential interactions, though false positives and negatives are common.

  • Fluorescence resonance energy transfer (FRET): For confirming direct interactions and determining their spatial distribution in living cells during sporulation.

  • Split fluorescent protein complementation: Provides strong visual confirmation of interactions in their native context.

  • Mass spectrometry-based approaches: Including SILAC (stable isotope labeling by amino acids in cell culture) to identify and quantify the entire interactome of SpoIV at different sporulation stages.

To ensure biological relevance, all interactions should be validated using multiple methods and tested under both vegetative growth and sporulation conditions. Researchers should be particularly attentive to temporal aspects, as interactions may be stage-specific during the sporulation process .

How should researchers interpret differential gene expression data in spoIV mutant studies?

Interpreting differential gene expression data from spoIV mutant studies requires sophisticated analytical approaches that account for the complex regulatory networks involved in sporulation. Based on findings from similar studies with spoIIE mutants, researchers should consider:

  • Temporal dynamics: Analyze gene expression at multiple time points (e.g., early, middle, and late sporulation) to capture the dynamic effects of spoIV mutation. In spoIIE studies, different genes were affected at different time points, reflecting the cascading nature of sporulation regulation .

  • Network analysis: Beyond individual differentially expressed genes, identify affected regulatory networks and pathways. In spoIIE mutants, genes involved in diverse cellular processes including stress response, cell wall formation, and metabolism were affected .

  • Direct vs. indirect effects: Use computational approaches to distinguish likely direct targets from downstream effects:

    • Genes with binding motifs for relevant sigma factors

    • Genes affected earliest after mutation

    • Genes known to be co-regulated in previous studies

  • Functional categorization: Group differentially expressed genes using COG (Clusters of Orthologous Groups) or GO (Gene Ontology) analysis. This approach revealed that spoIIE inactivation affected multiple functional groups including stress response and central metabolism .

When interpreting results, researchers should keep in mind that a significant percentage (45% in spoIIE studies) of differentially expressed genes may encode proteins of unknown function, highlighting potential novel components of the sporulation machinery .

What statistical approaches are appropriate for analyzing sporulation efficiency data?

When analyzing sporulation efficiency data in studies involving SpoIV, researchers should employ rigorous statistical approaches that account for the unique characteristics of sporulation experiments:

Statistical MethodApplicationAdvantages
Log transformationRaw sporulation efficiency dataNormalizes highly skewed data typical in sporulation counts
ANOVA with post-hoc testsComparing multiple strains/conditionsIdentifies significant differences while controlling for multiple comparisons
Mixed-effects modelsExperiments with repeated measuresAccounts for batch effects and technical variability
Survival analysisTime-to-sporulation dataHandles censored data and focuses on rate differences
Non-parametric testsWhen assumptions of normality are violatedRobust against outliers common in biological replicates

When reporting results, include both the mean and standard deviation (or standard error) of sporulation efficiency, and always report the number of independent biological replicates (minimum three recommended). For sporulation kinetics, consider time-to-event analyses that can reveal subtle differences in sporulation timing even when final efficiencies are similar . Statistical significance should be reported with exact p-values rather than simply as "significant" or "not significant," and appropriate multiple testing corrections should be applied when comparing multiple strains or conditions.

What genomic approaches could advance our understanding of SpoIV conservation and evolution?

Advanced genomic approaches offer powerful tools to investigate the conservation, evolution, and functional diversification of SpoIV across bacterial species. Researchers should consider:

  • Comparative genomics: Analyze spoIV homologs across diverse Bacillus species and other spore-forming bacteria to identify:

    • Core conserved domains that likely represent essential functional regions

    • Species-specific variations that may reflect adaptation to different ecological niches

    • Patterns of co-evolution with other sporulation genes

  • Phylogenetic analysis: Construct robust phylogenetic trees of spoIV sequences to:

    • Trace the evolutionary history of the gene

    • Identify potential horizontal gene transfer events

    • Correlate sequence changes with adaptations to different environments

  • Ancestral sequence reconstruction: Computationally predict ancestral SpoIV sequences to:

    • Test hypotheses about functional evolution through resurrection of ancestral proteins

    • Identify key mutations that led to functional changes

  • Population genomics: Analyze variation in spoIV sequences within species to:

    • Identify regions under selective pressure

    • Detect signatures of positive or purifying selection

    • Understand intraspecies functional diversity

  • Synthetic biology approaches: Use CRISPR-based genome editing to:

    • Replace native spoIV with homologs from other species

    • Create chimeric proteins to identify functional domains

    • Test evolutionary hypotheses through directed evolution

These approaches would provide valuable insights into how SpoIV has evolved and diversified across bacterial species, potentially revealing novel aspects of its function and regulation .

How might systems biology approaches enhance our understanding of SpoIV in the sporulation regulatory network?

Systems biology approaches offer powerful frameworks for understanding SpoIV's role within the complex regulatory networks governing sporulation. Based on successful applications to other sporulation proteins, researchers should consider:

  • Integrated multi-omics analyses: Combine transcriptomics, proteomics, metabolomics, and epigenomics data from wild-type and spoIV mutant strains to construct comprehensive models of the sporulation process. This approach revealed that spoIIE inactivation affects multiple cellular processes beyond sporulation .

  • Network inference algorithms: Apply computational methods to multi-omics datasets to infer regulatory relationships, identifying both direct and indirect effects of SpoIV on the sporulation network.

  • Mathematical modeling: Develop dynamic mathematical models of sporulation that incorporate SpoIV function:

    • Ordinary differential equation models to capture temporal dynamics

    • Stochastic models to account for cell-to-cell variability

    • Spatial models to represent compartmentalization effects

  • Single-cell analyses: Apply single-cell RNA-seq and time-lapse microscopy to:

    • Characterize cell-to-cell variability in sporulation responses

    • Identify population heterogeneity that may be masked in bulk analyses

    • Correlate gene expression patterns with morphological changes

  • Synthetic biology approaches: Construct minimal sporulation circuits to:

    • Test sufficiency of predicted regulatory interactions

    • Isolate SpoIV function from confounding factors

    • Engineer novel sporulation behaviors

These systems approaches would help place SpoIV within the broader context of bacterial development, potentially revealing emergent properties and regulatory principles that cannot be discovered through reductionist approaches alone .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.