Recombinant Bacillus pseudofirmus ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; BpOF4_06870; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-163
Protein Length
full length protein
Species
Bacillus pseudofirmus (strain OF4)
Target Names
atpF
Target Protein Sequence
MGFDINWGSALYQLLAFSVLLFFLSKFALKPLLGIMEKREQMINEQISSAEKNRKDSEAF IAEQRQALEQARMEANEIIQNAKKLSEQQGQDIVKAARNDAERIKESAVAEIQREKEQAV SALREQVAGLSVLIATKVIEKELNEAEQEKLVQEYLKEVGEEL
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous catalytic F1 domain and the membrane-bound proton channel F0 domain, connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the functional role of subunit b (atpF) in the ATP synthase complex of Bacillus pseudofirmus OF4?

Subunit b (atpF) is a critical structural component of the F-type ATP synthase in B. pseudofirmus OF4, serving as part of the peripheral stalk (stator) that connects the membrane-embedded F₀ domain to the catalytic F₁ domain. This connection is essential for preventing rotation of the α₃β₃ hexamer during catalysis, thus enabling the enzyme to couple the energy of an electrochemical H⁺ gradient to ATP synthesis.

In B. pseudofirmus OF4, the ATP synthase contains eight structural genes for the complete F-ATPase complex, which are preceded by an atpI gene encoding a membrane protein and an atpZ gene upstream of atpI . The atpF gene encoding subunit b is integrated within this operon, ensuring coordinated expression with other ATP synthase components essential for function in alkaline environments.

How is the ATP synthase of B. pseudofirmus adapted to function in alkaline environments?

The ATP synthase of alkaliphilic B. pseudofirmus OF4 exhibits several unique adaptations that enable it to function optimally at high pH (>10). One of the most notable adaptations is found in the c-subunit rotor ring, which contains an AxAxAxA motif near the center of the inner helix, where neutralophilic bacteria generally have a GxGxGxG motif . This alkaliphile-specific motif is crucial for maintaining optimal function in high pH environments.

The c-ring of B. pseudofirmus ATP synthase has a tridecameric (c₁₃) stoichiometry, compared to smaller c-rings (often c₁₀-c₁₁) in neutralophilic bacteria. This adaptation directly impacts the ion-to-ATP ratio during enzyme operation, which is a cornerstone parameter of cell bioenergetics . When the alanine residues in this motif are mutated to glycine, the resulting c₁₂ mutants show considerably reduced capacity to grow at high pH, demonstrating the importance of these structural adaptations .

What techniques are commonly used to express recombinant B. pseudofirmus atpF for research purposes?

Expression of recombinant B. pseudofirmus atpF typically employs the following methodology:

  • Gene amplification: PCR amplification of the atpF gene from B. pseudofirmus OF4 genomic DNA using specific primers designed based on the genomic sequence.

  • Vector construction: Cloning the amplified gene into an appropriate expression vector (commonly pET series for E. coli) with a fusion tag (His₆, MBP, etc.) to facilitate purification.

  • Expression host selection: Transformation into an appropriate E. coli strain (BL21(DE3) or derivatives) optimized for membrane protein expression.

  • Expression optimization: Careful optimization of expression conditions:

    • Temperature: Often lowered to 18-25°C to enhance proper folding

    • Induction: IPTG concentration typically 0.1-0.5 mM

    • Media: Rich media (LB) or defined media supplemented with appropriate cofactors

    • Duration: Extended expression periods (16-24 hours) at lower temperatures

  • Extraction and purification: Membrane fraction isolation followed by detergent solubilization (commonly DDM, LDAO, or C₁₂E₈) and purification via affinity chromatography and size exclusion chromatography.

The specific conditions must be carefully optimized due to the challenges associated with membrane protein expression and the unique properties of proteins from alkaliphilic organisms.

How does the c-ring stoichiometry of ATP synthase impact the bioenergetics of B. pseudofirmus, and what implications might this have for subunit b function?

The c-ring stoichiometry directly determines the ion-to-ATP ratio during ATP synthesis, a critical parameter for cellular bioenergetics. In B. pseudofirmus OF4, the native c₁₃ ring provides a precise balance between energy conservation and the bioenergetic challenges faced at high pH .

Table 1: Comparison of ATP Synthase c-ring Properties in Wild-type and Mutant B. pseudofirmus OF4

PropertyWild-type (c₁₃)Mutant (c₁₂)
c-subunit motifAxAxAxAGxAxAxA or AxGxAxA
Growth capacity at pH >10OptimalReduced
Molar growth yield on malateHigherLower
c-ring mobility on SDS-PAGEReferenceIncreased
ATP synthesis capability100%Reduced but functional

Research indicates that mutants with alanine-to-glycine substitutions in the c-subunit form smaller c₁₂ rings compared to the wild-type c₁₃, with a considerably reduced capacity to grow on limiting malate at high pH . This suggests that the precise stoichiometry is an evolutionary adaptation to the extreme environment.

For subunit b research, this implies that the peripheral stalk components (including subunit b) must be adapted to interact optimally with the c₁₃ rotor assembly. Any structural or functional studies of recombinant atpF should consider these interactions and how they might differ from those in neutralophilic bacteria with different c-ring stoichiometries.

What are the challenges and solutions for studying the structure-function relationship of B. pseudofirmus atpF through site-directed mutagenesis?

Challenges:

  • Target selection complexity: Identifying critical residues in atpF without prior structural data specific to B. pseudofirmus is difficult.

  • Phenotypic assessment: Mutation effects may be subtle or conditional, manifesting only under specific pH or growth conditions.

  • Protein stability: Mutations may affect stability rather than direct function, complicating interpretation.

  • Integration with complex: Ensuring proper assembly of mutated subunit b with the complete ATP synthase.

Methodological Solutions:

  • Comprehensive mutation strategy:

    • Align sequences of atpF from alkaliphiles and neutralophiles to identify conserved and divergent regions

    • Focus on charged residues likely involved in subunit interactions

    • Create systematic alanine scanning mutants in predicted interaction domains

  • Expression and functional analysis:

    • Express mutant proteins in both homologous (B. pseudofirmus) and heterologous (E. coli) systems

    • Assess ATP synthesis in membrane vesicles at both neutral (pH 7.5) and alkaline (pH 10.5) conditions following methods used for c-subunit studies

    • Measure growth yields under various pH conditions with limiting carbon sources

  • Structural integrity assessment:

    • Use SDS-PAGE and BN-PAGE to analyze stability of isolated components and assembled complexes

    • Apply trichloroacetic acid treatment to assess protein-protein interactions by methods similar to those used for c-rotor analysis

  • In vivo complementation:

    • Construct chromosomal mutants through allelic exchange

    • Test complementation with wild-type and mutant variants

Building on methodologies used for c-subunit mutations, where altered mobility on SDS-PAGE correlated with functional defects , similar approaches could reveal structure-function relationships in atpF.

How might the atpZ and atpI genes, which precede the structural genes in the ATP synthase operon, interact with or affect subunit b function?

The ATP synthase operon of B. pseudofirmus OF4 contains ten genes, including atpZ and atpI upstream of the eight structural genes . These additional genes may have significant implications for ATP synthase assembly and function, including potential interactions with subunit b.

Research indicates that AtpZ and AtpI are membrane proteins that function as Mg²⁺ transporters, Ca²⁺ transporters, or channel proteins . Deletion of atpZ, atpI, or both from B. pseudofirmus OF4 leads to a requirement for greatly increased concentration of Mg²⁺ for growth at pH 7.5 .

Potential interactions with subunit b:

  • Ion availability for ATP synthase: AtpZ and AtpI may provide Mg²⁺, which is required by ATP synthase, potentially affecting the local ion environment around subunit b.

  • Charge compensation: These proteins might support charge compensation when the enzyme functions in the hydrolytic direction, particularly during cytoplasmic pH regulation .

  • Complex assembly: They may participate in ATP synthase assembly, potentially interacting with membrane-embedded components including subunit b.

Experimental approaches to investigate interactions:

  • Co-immunoprecipitation: Using antibodies against AtpZ, AtpI, or subunit b to identify physical interactions.

  • Two-hybrid analysis: Bacterial two-hybrid systems to detect protein-protein interactions.

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry to identify interacting residues.

  • Functional studies: Compare ATP synthase activity in wild-type versus ΔatpZ, ΔatpI, or ΔatpZI strains, particularly focusing on effects at different pH values and Mg²⁺ concentrations.

What experimental approaches can be used to investigate how the alkaliphilic environment affects the structure and stability of the ATP synthase b subunit?

Structural analysis approaches:

  • Comparative biophysical studies:

    • Circular dichroism (CD) spectroscopy to compare secondary structure at varying pH (7.5-10.5)

    • Fluorescence spectroscopy to monitor tertiary structure changes

    • Thermal stability assays using differential scanning calorimetry or thermal shift assays at different pH values

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Compare hydrogen-deuterium exchange rates at different pH values

    • Identify regions with altered solvent accessibility or flexibility

  • Limited proteolysis:

    • Assess proteolytic susceptibility at varying pH to identify conformational changes

    • Map exposed regions that may participate in pH-dependent interactions

Functional approaches:

  • Reconstitution experiments:

    • Reconstitute purified subunit b with other ATP synthase components in liposomes

    • Measure ATP synthesis/hydrolysis rates across a pH range (7.5-10.5)

    • Compare rate-pH profiles of wild-type versus mutant proteins

  • Protein-protein interaction studies:

    • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to measure binding affinities between subunit b and other ATP synthase components at different pH values

    • Assess how pH affects the strength and specificity of these interactions

  • In vivo complementation studies:

    • Express B. pseudofirmus atpF in ATP synthase-deficient E. coli

    • Assess function at different pH values compared to E. coli atpF

These approaches parallel methodologies used to study c-subunit adaptations, where mutations in the AxAxAxA motif showed pH-dependent functional effects and altered complex stability .

What purification strategies yield the highest quality recombinant B. pseudofirmus atpF protein for structural studies?

Optimized purification protocol:

  • Cell lysis and membrane preparation:

    • Mechanical disruption (French press or sonication) in buffer containing protease inhibitors

    • Differential centrifugation to isolate membrane fraction (10,000×g followed by 100,000×g)

    • Membrane washing to remove peripheral proteins

  • Detergent screening and solubilization:

    • Systematic testing of detergents (mild non-ionic: DDM, LMNG; zwitterionic: LDAO, Fos-choline)

    • Optimal solubilization: 1% detergent, 4°C, 1-2 hours

    • Centrifugation at 100,000×g to remove insoluble material

  • Multi-step chromatography:

    • IMAC purification (Ni-NTA for His-tagged protein)

    • Ion exchange chromatography to remove contaminants

    • Size exclusion chromatography for final polishing and assessment of homogeneity

  • Stability optimization:

    • Buffer screening to identify optimal pH and salt conditions

    • Inclusion of lipids (E. coli polar lipids or synthetic lipids) to maintain native-like environment

    • Addition of stabilizing agents (glycerol, specific ions like Mg²⁺)

Quality assessment metrics:

  • Purity assessment:

    • SDS-PAGE: >95% purity

    • Mass spectrometry to confirm identity and detect modifications

  • Structural integrity:

    • Circular dichroism to confirm secondary structure

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to assess oligomeric state

  • Functional validation:

    • Binding assays with interaction partners

    • Reconstitution with other ATP synthase components to assess complex formation

This approach builds on methodologies used for other ATP synthase components from B. pseudofirmus OF4, which have yielded samples suitable for crystallographic studies .

How can researchers distinguish between direct effects of mutations on subunit b function versus indirect effects on ATP synthase assembly?

Distinguishing direct functional effects from assembly defects requires a multi-faceted experimental approach:

Assembly analysis:

  • Blue Native PAGE (BN-PAGE):

    • Compare migration patterns of ATP synthase complexes from wild-type and mutant strains

    • Quantify relative amounts of fully assembled complex versus subcomplexes

  • Sucrose gradient centrifugation:

    • Separate ATP synthase components based on size

    • Western blot analysis to detect distribution of subunit b and other components

  • Crosslinking and mass spectrometry:

    • Apply in vivo crosslinking to capture native interactions

    • Analyze crosslinked products to identify altered interaction patterns in mutants

Functional analysis of assembled complexes:

  • ATP synthesis assays in membrane vesicles:

    • Normalize activity to amount of fully assembled complex (determined by BN-PAGE)

    • Compare specific activities at pH 7.5 and pH 10.5, as performed for c-subunit mutations

  • ATP hydrolysis assays:

    • Measure ATP hydrolysis rates of purified complexes

    • Assess pH dependence and ion specificity

  • Proton pumping measurements:

    • Monitor pH-sensitive fluorescent dyes to assess proton translocation in reconstituted systems

    • Compare coupling ratios (ATP hydrolyzed per proton pumped) between wild-type and mutants

Direct structure-function correlations:

  • Isolated subunit b studies:

    • Express and purify wild-type and mutant subunit b

    • Compare structural properties (secondary structure, stability)

    • Assess direct binding to partner subunits in isolation

  • Complementation approach:

    • Express wild-type B. pseudofirmus subunit b in appropriate backgrounds to rescue assembly

    • Test if functional defects persist despite proper assembly

This methodological framework would help distinguish assembly defects from functional alterations, similar to approaches used for c-subunit studies where mobility on SDS-PAGE correlated with functional changes but not necessarily with c-ring stability loss in vitro .

What experimental design would best elucidate the adaptation mechanisms of ATP synthase subunit b to alkaline environments?

An optimal experimental design would include comparative, functional, and evolutionary approaches:

Comparative sequence-structure analysis:

  • Comprehensive sequence analysis:

    • Multiple sequence alignment of subunit b sequences from:

      • Alkaliphiles (B. pseudofirmus, B. halodurans, etc.)

      • Neutralophiles (B. subtilis, E. coli)

      • Other extremophiles (thermophiles, acidophiles)

    • Identification of conserved alkaliphile-specific residues

  • Structural prediction and comparison:

    • Homology modeling of B. pseudofirmus subunit b

    • Analysis of charge distribution, hydrophobicity, and predicted flexibility

    • Identification of potential alkaliphile-specific structural features

Functional characterization:

  • pH-dependent functional assays:

    • Express recombinant ATP synthases containing chimeric or mutated subunit b

    • Measure ATP synthesis in membrane vesicles across pH range (7.5-10.5)

    • Design based on methodologies used for c-subunit studies

  • Growth phenotype analysis:

    • Construct B. pseudofirmus strains with mutations in identified adaptation regions

    • Assess growth rates and yields at different pH values and limiting nutrients

    • Compare molar growth yields on malate as done for c-ring stoichiometry mutants

Table 2: Experimental Framework for Adaptation Analysis

ApproachExperimental MethodExpected OutcomeControl/Comparison
Sequence comparisonMultiple sequence alignmentIdentification of alkaliphile-specific residuesNeutralophile sequences
Structural analysisHomology modeling, molecular dynamicsPrediction of pH-sensitive regionsModels at different pH
Domain swappingCreation of chimeric subunit bLocalization of adaptation domainsGrowth complementation
Site-directed mutagenesisPoint mutations at key residuesFunctional importance of specific adaptationsWild-type performance
Physiological testingGrowth measurements at varying pHIn vivo relevance of adaptationsGrowth on different carbon sources

This multi-faceted approach would reveal both structural and functional adaptations in subunit b, similar to how the c-ring stoichiometry and AxAxAxA motif were identified as critical adaptations in the c-subunit for optimal growth at pH >10 .

How might the study of B. pseudofirmus ATP synthase subunit b contribute to our understanding of bioenergetic adaptations in extremophiles?

Research on B. pseudofirmus ATP synthase subunit b offers several opportunities to advance our understanding of extremophile bioenergetics:

  • Overcoming bioenergetic challenges:

    • Alkaliphiles face the fundamental challenge of maintaining ATP synthesis despite an inverted pH gradient

    • Subunit b adaptations may reveal mechanisms for optimizing energy coupling under adverse conditions

    • Findings may uncover general principles applicable to other extremophiles

  • Evolutionary insights:

    • Comparison of alkaliphile-specific adaptations across different ATP synthase components

    • Determination whether adaptations in subunit b coevolved with the c-ring adaptations

    • Investigation of the molecular basis for the "alkaliphile paradox" where ATP synthesis occurs despite unfavorable proton gradients

  • Structure-function relationships:

    • Analysis of how peripheral stalk components contribute to ATP synthase stability in extreme environments

    • Identification of specific residues or motifs critical for stator function at high pH

    • Understanding the balance between structural rigidity and functional flexibility in energy-coupling membrane proteins

  • Biotechnological applications:

    • Development of robust biomimetic energy-converting systems inspired by alkaliphile adaptations

    • Design of pH-resistant enzyme complexes for biotechnological applications

    • Insight into engineering strategies for creating stable multisubunit membrane protein complexes

These studies could complement existing research on c-ring adaptations, where the unique AxAxAxA motif and c₁₃ stoichiometry have been shown to be critical for optimal function at high pH .

What role might subunit b play in the coordination between ATP synthase and the additional genes (atpZ and atpI) found in the B. pseudofirmus atp operon?

The B. pseudofirmus ATP synthase operon contains additional genes (atpZ and atpI) that are implicated in ion transport functions . The potential coordination between these components and subunit b represents an exciting research frontier:

  • Functional coupling hypothesis:

    • AtpZ and AtpI are implicated in Mg²⁺ transport and may provide ions necessary for ATP synthase function

    • Subunit b might serve as a structural or functional link between these auxiliary proteins and the ATP synthase core

    • The peripheral location of subunit b makes it a candidate for such interactions

  • Coordinated assembly model:

    • The overlap between atpZ and atpI genes suggests coordinated expression

    • Subunit b could participate in a larger assembly complex involving these additional components

    • Deletion studies show that atpZ/atpI deletion affects Mg²⁺ requirements, which might influence ATP synthase assembly or function

  • Ion homeostasis coordination:

    • AtpZ and AtpI are hypothesized to function as Mg²⁺ transporters, Ca²⁺ transporters, or channel proteins

    • ATP synthase requires ions for both catalysis and structural integrity

    • Subunit b might be positioned to sense or respond to local ion concentrations

  • Evolutionary significance:

    • The presence of these additional genes in alkaliphiles suggests an adaptation to their unique bioenergetic challenges

    • Understanding their interaction with ATP synthase components, including subunit b, may reveal novel regulatory mechanisms

Research approaches could include:

  • Protein-protein interaction studies (crosslinking, co-immunoprecipitation)

  • Functional studies of ATP synthase in strains with atpZ/atpI deletions

  • Localization studies to determine if these components co-localize in the membrane

  • Structural studies of potential complexes formed between subunit b and AtpZ/AtpI proteins

This research direction builds on findings that AtpZ and AtpI deletion affects Mg²⁺ requirements for growth at pH 7.5 , suggesting their importance in ion homeostasis related to ATP synthase function.

What are the most promising techniques for obtaining high-resolution structural information about B. pseudofirmus ATP synthase subunit b?

The most promising structural biology approaches for B. pseudofirmus ATP synthase subunit b include:

  • Cryo-electron microscopy (cryo-EM):

    • Most promising for capturing subunit b in the context of the complete ATP synthase

    • Recent advances allow near-atomic resolution of membrane protein complexes

    • Allows visualization of different conformational states

    • May reveal alkaliphile-specific structural features absent in neutralophile homologs

  • X-ray crystallography of subcomplexes:

    • Focus on stable subcomplexes containing subunit b (e.g., b-δ complex)

    • Use of crystallization chaperones (antibody fragments, nanobodies)

    • Lipidic cubic phase crystallization for membrane-associated regions

    • Building on successful strategies used for c-ring crystallization (PDB: 3ZO6)

  • Integrative structural biology:

    • Combine multiple complementary techniques:

      • Hydrogen-deuterium exchange mass spectrometry for dynamics

      • Cross-linking mass spectrometry for interaction interfaces

      • Small-angle X-ray scattering for solution conformation

      • NMR for specific domains or flexible regions

    • Computational integration of diverse structural data

  • In situ structural approaches:

    • Cryo-electron tomography of bacterial cells or membrane vesicles

    • Correlative light and electron microscopy to locate and visualize ATP synthase in native membranes

    • Potentially revealing native interactions with AtpZ and AtpI proteins

These approaches build upon the successful structural characterization of the B. pseudofirmus c-ring by X-ray crystallography , extending structural insights to the peripheral stalk components including subunit b.

How might research on B. pseudofirmus ATP synthase subunit b inform bioenergetic engineering applications?

Research on B. pseudofirmus ATP synthase subunit b has several potential applications in bioenergetic engineering:

  • Design of pH-resistant bioenergetic systems:

    • Engineering robust ATP synthases for biofuel cells operating in alkaline conditions

    • Creating artificial photosynthetic systems with enhanced tolerance to pH fluctuations

    • Developing bioelectrochemical systems for waste remediation at high pH

  • Optimization of enzyme function in extreme environments:

    • Identification of key structural elements that confer alkaline stability

    • Application of these principles to other membrane protein complexes

    • Engineering of pH-adaptive energy-converting enzymes

  • Biomimetic energy conversion technologies:

    • Design of synthetic rotary motors inspired by alkaliphile ATP synthase adaptations

    • Creation of artificial proton pumps with optimized function across pH ranges

    • Development of nanoscale devices that maintain function despite adverse gradients

  • Metabolic engineering of industrial microorganisms:

    • Enhancing ATP production efficiency in industrial fermentation processes

    • Improving growth and productivity at non-optimal pH conditions

    • Engineering microbes for enhanced bioenergy production or carbon fixation

The unique adaptations found in B. pseudofirmus ATP synthase, such as the c-ring stoichiometry and composition that allow it to function optimally at pH >10 , represent evolved solutions to challenging bioenergetic problems. Understanding how subunit b contributes to these adaptations could provide valuable design principles for synthetic biology and bioenergetic engineering applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.