Recombinant Bacillus pseudofirmus Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ecfT; BpOF4_08710; Energy-coupling factor transporter transmembrane protein EcfT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Bacillus pseudofirmus (strain OF4)
Target Names
ecfT
Target Protein Sequence
MFQNVIIGQYVQGNSFLHKLDPRSKLISVFILLIIIFFADNWFSSLLLVGLTVMLMAISR VPLLFLYRGLRPILWLVLFTLILHILLTKEGPVLMTLGPIAIHEGGVMNGLFIATRLLTL VMLTSLITLTTSPIDLTDGLESLFTPLKKVGLPAHELALMMSIALRFIPTFMQETEKILK AQMARGVDFSSGPISKRVKALLPLLVPLFISAFKRAEDLALAMEARGYRGGEGRTKLRVL MWNGKDSFVVVSALVIGVGIILLRNG
Uniprot No.

Target Background

Function

The transmembrane (T) component of an energy-coupling factor (ECF) ABC-transporter complex. Unlike classical ABC transporters, this ECF transporter uniquely provides the energy required for the transport of diverse substrates.

Database Links
Protein Families
Energy-coupling factor EcfT family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Bacillus pseudofirmus EcfT and what is its function in bacterial systems?

    Bacillus pseudofirmus EcfT is a transmembrane protein component of the Energy-Coupling Factor (ECF) transporter system found in the alkaliphilic bacterium Bacillus pseudofirmus. This bacterium is a gram-positive, facultative anaerobe that can thrive in highly alkaline environments with pH values above 11 .

    The EcfT protein functions as the central transmembrane scaffold component of ECF transporters, which are a specialized class of ATP-binding cassette (ABC) transporters responsible for the uptake of essential micronutrients and vitamins in prokaryotes . The full-length EcfT protein in B. pseudofirmus consists of 266 amino acids and contains multiple transmembrane domains that anchor the ECF complex in the cell membrane .

    In the ECF transporter complex, EcfT serves as a coupling protein that connects the cytoplasmic ATP-binding cassette components (EcfA and EcfA') with the substrate-binding components (S-components). This arrangement facilitates the energy transduction from ATP hydrolysis to substrate transport across the membrane .

  • How does the structure of B. pseudofirmus ECF transporters compare to other bacterial ECF systems?

    The ECF transporter in B. pseudofirmus follows the general structural organization seen in other bacterial species, but with specific adaptations that may relate to its alkaliphilic lifestyle. Based on the available research, ECF transporters typically consist of four components:

    • EcfT: The transmembrane scaffold component

    • EcfA/EcfA': Two cytoplasmic ATP-binding/hydrolysis components

    • S-component: A substrate-binding membrane protein

    Studies on the ECF transporter from Thermotoga maritima suggest a 1A:1A':2T:2S (3×2) model for the complete transporter complex . This model proposes that the functional ECF transporter contains two copies of the transmembrane T subunit and two S-components, along with one copy each of the A and A' ATPase subunits.

    The amino acid sequence of B. pseudofirmus EcfT (D3FRP0) contains characteristic features of ECF transporters, including two conserved Ala-Arg motifs that likely form interaction interfaces with the ATPase subunits . These motifs are critical for energy coupling between ATP hydrolysis and substrate transport.

  • What methods are available for expressing and purifying recombinant B. pseudofirmus EcfT for structural studies?

    Expression and purification of recombinant B. pseudofirmus EcfT typically follows these methodological approaches:

    1. Expression System: E. coli is the preferred heterologous expression system for recombinant EcfT production . The protein is often expressed with an N-terminal His-tag to facilitate purification.

    2. Purification Protocol:

      • Initial capture using immobilized metal affinity chromatography (IMAC)

      • Buffer exchange to remove imidazole

      • Size exclusion chromatography to isolate the monomeric protein

      • Optional detergent exchange depending on downstream applications

    3. Quality Control:

      • SDS-PAGE analysis to confirm >90% purity

      • Western blotting with anti-His antibodies

      • Circular dichroism to verify secondary structure integrity

    4. Storage Considerations:

      • Lyophilization in Tris/PBS-based buffer with 6% trehalose at pH 8.0

      • Reconstitution in deionized sterile water to 0.1-1.0 mg/mL

      • Addition of glycerol (5-50%) and aliquoting for long-term storage at -20°C/-80°C

    For structural studies, it's crucial to maintain the native conformation of the protein during purification. Detergent selection is particularly important for membrane proteins like EcfT, with mild detergents such as DDM (n-dodecyl-β-D-maltopyranoside) often preferred to preserve protein structure and function.

  • What is the genetic organization of the ECF transporter genes in B. pseudofirmus?

    The genetic organization of ECF transporter genes in B. pseudofirmus follows patterns observed in other Bacilli species. In Bacilli, the ECF transporter genes are typically organized in the "ecf operon" (ecfA1-ecfA2-ecfT-truA-rplM-rpsI) . This operon is part of a larger and highly conserved gene cluster known as the secE-rpoBC-str-S10-spc-alpha operon cluster.

    A reconstruction of the ancestral operon clusters in Bacilli revealed that this ecf operon is positioned downstream of the core operon cluster, suggesting its importance in the evolution of these bacteria . The specific gene identifier for B. pseudofirmus EcfT is BpOF4_08710 (UniProt ID: D3FRP0) .

    The genomic context of the ecf operon provides insights into its evolutionary history and functional relationships. The proximity of the ecf genes to genes encoding ribosomal proteins (rplM, rpsI) and tRNA processing enzymes (truA) suggests a coordinated expression pattern that may link nutrient uptake with protein synthesis machinery.

Advanced Research Questions

Methodological Questions

  • How can researchers optimize the expression and solubilization of recombinant B. pseudofirmus EcfT?

    Optimizing the expression and solubilization of recombinant B. pseudofirmus EcfT requires addressing several challenges associated with membrane protein production:

    1. Expression System Selection:

      • E. coli is commonly used, with strains like BL21(DE3) or C41(DE3) preferred for membrane proteins

      • Consider using weak promoters to prevent inclusion body formation

      • Evaluate IPTG concentration and induction temperature (typically lower temperatures of 16-20°C)

    2. Vector Design:

      • Include fusion tags that enhance folding (e.g., MBP, SUMO)

      • Position the His-tag at the N-terminus as shown for commercial preparations

      • Consider codon optimization for E. coli expression

    3. Membrane Extraction Optimization:

      • Screen multiple detergents (DDM, LMNG, CHAPS) at different concentrations

      • Test solubilization times (2-24 hours) and temperatures (4°C vs. room temperature)

      • Consider addition of lipids during solubilization to stabilize the protein

    4. Protein Stabilization:

      • Include glycerol (10-20%) in all buffers

      • Add specific lipids that may be required for stability

      • Maintain pH at 8.0, which appears optimal for B. pseudofirmus proteins

    5. Quality Control Checkpoints:

      • Monitor protein folding using circular dichroism

      • Assess aggregation state by size exclusion chromatography

      • Verify functional activity through ATPase assays with reconstituted complexes

    A systematic approach to optimization would involve creating a matrix of conditions and evaluating protein yield, purity, and activity for each condition.

  • What analytical techniques can be used to determine the ATP hydrolysis kinetics of B. pseudofirmus ECF transporters?

    Determining ATP hydrolysis kinetics of B. pseudofirmus ECF transporters requires specialized analytical techniques. The following methodological approaches can be employed:

    1. Malachite Green Phosphate Assay:

      • Measures released inorganic phosphate from ATP hydrolysis

      • Allows for high-throughput screening of multiple conditions

      • Can be used to determine Km and Vmax values for ATP hydrolysis

    2. Coupled Enzyme Assays:

      • Links ATP hydrolysis to NADH oxidation via pyruvate kinase and lactate dehydrogenase

      • Provides real-time monitoring of ATPase activity

      • Allows for continuous measurement of reaction kinetics

    3. Radiolabeled ATP Assays:

      • Uses [γ-32P]ATP to track phosphate release with high sensitivity

      • Particularly useful for low activity levels

      • Requires special handling due to radioactivity

    4. Bioluminescence Assays:

      • Measures remaining ATP using luciferase

      • Provides high sensitivity detection

      • Useful for endpoint measurements

    When studying ECF transporters specifically, it's important to reconstitute the complete complex (EcfA, EcfA', EcfT, and S-component) as the individual components may have different ATPase activities compared to the intact complex. Research on related ECF transporters has shown that the substrate-binding component can stimulate the ATPase activity of the complex .

    Experimental design considerations should include:

    • Buffer composition (pH, salt concentration)

    • Substrate availability

    • Temperature control

    • Time course measurements

    • Controls for background phosphate contamination

  • How can researchers investigate the role of B. pseudofirmus EcfT in alkaline adaptation mechanisms?

    Investigating the role of B. pseudofirmus EcfT in alkaline adaptation mechanisms requires a multifaceted experimental approach:

    1. Comparative Sequence Analysis:

      • Compare EcfT sequences from alkaliphilic and non-alkaliphilic Bacillus species

      • Identify amino acid substitutions that may contribute to alkaline stability

      • Use bioinformatics tools to predict the impact of these substitutions on protein structure and function

    2. Site-Directed Mutagenesis:

      • Create chimeric proteins by swapping domains between alkaliphilic and neutralophilic EcfT proteins

      • Introduce specific mutations at conserved sites

      • Assess the impact on protein stability and function at different pH values

    3. Growth Complementation Assays:

      • Generate EcfT knockout strains in B. pseudofirmus

      • Complement with wild-type or mutant EcfT variants

      • Compare growth rates at different pH values (7.5-11.4)

    4. Membrane Vesicle Transport Assays:

      • Prepare inside-out membrane vesicles from cells expressing different EcfT variants

      • Measure substrate transport at different pH values

      • Determine pH optima and kinetic parameters

    5. ATP Synthesis and Hydrolysis Measurements:

      • Similar to studies with B. pseudofirmus cytochrome enzymes , measure ATP synthesis by ADP+Pi-loaded membrane vesicles at pH 7.5 and 10.5

      • Compare ATP hydrolysis rates at different pH values

      • Determine the coupling efficiency between ATP hydrolysis and substrate transport

    B. pseudofirmus OF4 is known to grow non-fermentatively in a pH range from ~7.5 to above 11.4 , making it an excellent model system for studying alkaline adaptation. Previous studies have shown that certain enzymes in B. pseudofirmus, such as ATP synthase, have specific adaptations for functioning at high pH . Similar adaptations might exist in the EcfT protein, particularly in the transmembrane domains that interact with the alkaline environment.

  • What approaches can resolve contradictions in the literature regarding ECF transporter mechanisms?

    Resolving contradictions in the literature regarding ECF transporter mechanisms requires systematic experimental approaches and careful interpretation of results:

    1. Standardized Experimental Systems:

      • Establish consistent protein expression and purification protocols

      • Use the same detergents and lipid compositions for reconstitution

      • Control experimental conditions (pH, temperature, ionic strength) across studies

    2. Multi-technique Validation:

      • Apply complementary structural methods (X-ray crystallography, cryo-EM, NMR)

      • Combine structural insights with functional assays

      • Use both in vitro and in vivo approaches to validate findings

    3. Direct Comparison Studies:

      • Directly compare different ECF transporters under identical conditions

      • Systematically vary one parameter at a time to identify sources of discrepancies

      • Include positive and negative controls in all experiments

    4. Advanced Biophysical Techniques:

      • Single-molecule FRET to track conformational changes

      • Hydrogen-deuterium exchange mass spectrometry to map protein dynamics

      • Electron paramagnetic resonance spectroscopy with site-directed spin labeling

    5. Experimental Design Considerations:

      • Apply principles of rigorous experimental design

      • Include appropriate controls and replicates

      • Use statistical methods to evaluate significance of findings

    One specific contradiction in the literature concerns the stoichiometry of the ECF transporter complex. While some models propose a 1A:1A':1T:1S (1×4) arrangement , other studies support a 1A:1A':2T:2S (3×2) model . This contradiction could be resolved through:

    • Native mass spectrometry of intact complexes

    • Quantitative cross-linking mass spectrometry

    • Single-particle cryo-EM analysis of purified complexes

    For B. pseudofirmus specifically, adapting these approaches to work at alkaline pH would be essential to understand how this specialized ECF transporter functions in its native environment.

Table: Comparison of Key Features of Bacillus pseudofirmus EcfT with Related Proteins

FeatureB. pseudofirmus EcfTB. subtilis EcfTT. maritima EcfTFunction/Significance
Protein Length266 amino acids 265 amino acids Not specifiedDefines structural organization
UniProt IDD3FRP0 P70972 Not specifiedReference identifier
Gene IdentifierBpOF4_08710 ybaF, BSU01470 Not specifiedGenomic location marker
Conserved MotifsAla-Arg motifsAla-Arg motifsAla-Arg motifsCritical for interaction with ATPase subunits
Optimal pH Function7.5-11.4 ~7.0Not specifiedReflects adaptation to alkaline environments
Expression SystemE. coli E. coli Not specifiedHeterologous production system
Storage BufferTris/PBS with 6% Trehalose, pH 8.0 Tris/PBS with 6% Trehalose, pH 8.0 Not specifiedStabilization conditions
Proposed StoichiometryLikely 2 copies in complexLikely 2 copies in complex2 copies in complex Important for symmetrical function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.