Recombinant Bacillus pseudofirmus Na (+)/H (+) antiporter subunit B (mrpB)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Bacillus pseudofirmus Na+^+/H+^+ antiporter subunit B (MrpB) is a key component of the hetero-oligomeric Mrp antiporter complex, which is critical for pH homeostasis and sodium resistance in alkaliphilic bacteria. This antiporter catalyzes electrogenic Na+^+(Li+^+)/H+^+ exchange, enabling cells to survive in high-pH environments by maintaining cytoplasmic pH and extruding toxic sodium ions .

Table 1: Key Properties of Recombinant MrpB

PropertyDetail
Gene sourcemrpB gene from Bacillus pseudofirmus OF4
Expression systemEscherichia coli (common heterologous host for Mrp complex studies)
Subunit interactionsForms subcomplexes with MrpA, MrpC, and MrpD
Functional requirementEssential for full Na+^+/H+^+ antiport activity

3.1. Role in Antiporter Assembly

  • Deletion of mrpB abolishes Na+^+/H+^+ antiport activity, indicating its necessity for complex assembly .

  • MrpB stabilizes interactions between MrpA and MrpD, as shown in B. subtilis homologs .

3.2. Mutagenesis Studies

  • Asp-121 mutation: Substitution of conserved Asp-121 in transmembrane helix 4 (TM4) reduces Na+^+ resistance by >90% in B. subtilis, suggesting a role in proton translocation .

  • His-tagged variants: Tagged MrpB retains partial activity in complementation assays, enabling biochemical purification .

3.3. Reconstitution and Activity

  • The full Mrp complex (including MrpB) reconstituted in proteoliposomes exhibits Na+^+/H+^+ antiport activity dependent on proton motive force (PMF) .

  • Activity parameters:

    • pH optimum: 8.0–9.0 .

    • Apparent KmK_m for Na+^+: 0.06–0.12 mM, among the lowest reported for bacterial antiporters .

Comparative Analysis with Homologs

FeatureB. pseudofirmus MrpBB. subtilis MrpBS. aureus MnhB
Transmembrane domains444
Conserved acidic sitesAsp-121 (predicted)Asp-121Asp-119
Role in Na+^+ effluxEssentialEssentialPartially dispensable

Applications and Implications

  • Biotechnological uses: Engineering pH-stable enzymes or synthetic biology systems requiring robust pH homeostasis .

  • Medical relevance: Homologs in pathogens like Staphylococcus aureus suggest potential antimicrobial targets .

Challenges and Future Directions

  • Structural insights: High-resolution cryo-EM structures of the Mrp complex (e.g., 2.2 Å resolution in B. pseudofirmus) highlight MrpB’s position but lack atomistic detail for its specific role .

  • Functional redundancy: MrpB’s role may overlap with other small subunits (e.g., MrpC), necessitating further mutagenesis studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We suggest centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specified tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
mrpB; BpOF4_13205; Na(+/H(+ antiporter subunit B; Mrp complex subunit B; Multiple resistance and pH homeostasis protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-144
Protein Length
full length protein
Species
Bacillus pseudofirmus (strain OF4)
Target Names
mrpB
Target Protein Sequence
MKNLKSNDVLLHTLTRVVTFIILAFSVYLFFAGHNNPGGGFIGGLMTASALLLMYLGFDM RSIKKAIPFDFTKMIAFGLLIAIFTGFGGLLVGDPYLTQYFEYYQIPILGETELTTALPF DLGIYLVVIGIALTIILTIAEDDM
Uniprot No.

Target Background

Function
The Mnh complex functions as a Na(+)Li(+)/H(+) antiporter involved in Na(+) and/or Li(+) excretion and Na(+) resistance. Na(+)/H(+) antiport consumes a transmembrane electrical potential, indicating its electrogenic nature. It does not transport K(+), Ca(2+), or Mg(2+).
Database Links
Protein Families
CPA3 antiporters (TC 2.A.63) subunit B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Mrp antiporter in Bacillus pseudofirmus and what is its physiological role?

The Mrp antiporter in Bacillus pseudofirmus OF4 is a multi-subunit membrane protein complex essential for survival in alkaline environments. It functions as a cation/proton antiporter that maintains cytoplasmic pH homeostasis by exchanging sodium ions for protons across the cell membrane. Under alkaline conditions, B. pseudofirmus depends on this antiporter to stabilize internal pH approximately two units below the external environment .

The antiporter complex consists of seven membrane subunits (MrpA through MrpG), with MrpB being one of these critical components. The Mrp system is electrogenic, with the number of protons transferred likely exceeding the number of sodium ions transported . This electrogenicity allows proton uptake against a concentration gradient, driven by the electrical component of the membrane potential (approximately -180 mV, inside negative) .

How is the mrp operon organized in B. pseudofirmus OF4?

The mrp operon in B. pseudofirmus OF4 encodes seven proteins (MrpA-G) that form the functional antiporter complex. Researchers have successfully engineered this operon to enable detection of all seven Mrp proteins in single samples . The genomic organization of this operon is critical for coordinated expression of all subunits.

When studying the mrp operon, researchers typically employ PCR-based approaches with primer pairs designed to amplify specific regions. For instance, methodologies similar to those used for other genes in B. pseudofirmus OF4 involve:

  • Designing primers that flank the target gene regions

  • Amplifying the gene using PCR with B. pseudofirmus OF4 chromosomal DNA as template

  • Cloning the purified PCR products into appropriate vectors

  • Verifying the constructs through sequencing

This approach has been successfully demonstrated for other genes in B. pseudofirmus OF4, such as csaB, where researchers used the gene SOEing (gene splicing by overlap extension) method .

What expression systems are most effective for recombinant production of MrpB?

For successful expression of recombinant B. pseudofirmus MrpB, E. coli-based expression systems have proven effective. The methodology typically involves:

  • Cloning the mrpB gene into an expression vector with an appropriate tag (commonly a His-tag for purification)

  • Transforming the construct into E. coli host cells

  • Inducing expression under controlled conditions

  • Extracting and purifying the protein using affinity chromatography

As demonstrated for the complete Mrp complex, researchers have successfully expressed recombinant His-tagged B. pseudofirmus Mrp antiporter complex in E. coli and purified it by affinity chromatography in lauryl maltose neopentyl glycol (LMNG) . This approach can be adapted specifically for MrpB expression.

For membrane proteins like MrpB, optimizing expression conditions is crucial. Parameters that require careful adjustment include:

  • Induction temperature (typically lower temperatures favor proper folding)

  • Inducer concentration

  • Duration of expression

  • Host strain selection (C41, C43, or other strains optimized for membrane protein expression)

What purification strategies are recommended for recombinant MrpB?

Purification of recombinant MrpB requires specialized approaches due to its membrane protein nature. Based on successful strategies for the complete Mrp complex, the following methodology is recommended:

  • Membrane extraction: Isolate cell membranes through differential centrifugation after cell lysis

  • Solubilization: Extract membrane proteins using appropriate detergents (LMNG has been successful for the Mrp complex)

  • Affinity chromatography: Utilize His-tag or other affinity tags for initial purification

  • Size exclusion chromatography: Further purify the protein and assess its oligomeric state

  • Quality control: Verify protein purity through SDS-PAGE and western blotting

This approach has yielded high-quality protein suitable for structural studies of the complete Mrp complex at 2.2 Å resolution , suggesting its effectiveness for individual subunits as well.

What molecular mechanisms underlie sodium and proton transport by the Mrp complex?

Molecular dynamics simulations based on the high-resolution structure of the B. pseudofirmus Mrp antiporter have revealed critical mechanistic details of ion transport:

  • A histidine-switch mechanism appears critical for proton transfer that drives trans-membrane sodium translocation

  • The switching position of a histidine residue between three hydrated pathways in the MrpA subunit is involved in this process

  • The complex contains putative sodium ion binding sites identified through MD simulations

  • Sodium ion translocation depends on protonation and conformational states of the antiporter

For investigating MrpB's specific role in this mechanism, researchers could:

  • Identify conserved charged or polar residues in MrpB that might participate in ion coordination

  • Perform electrophysiological measurements after reconstituting purified MrpB or the complete complex into liposomes

  • Conduct ion binding assays using isothermal titration calorimetry or fluorescence-based approaches

Understanding how MrpB coordinates with other subunits to facilitate this complex ion exchange process remains an active area of research.

How can site-directed mutagenesis be used to investigate critical residues in MrpB?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in MrpB. Based on methodologies used for other B. pseudofirmus proteins, researchers can implement the following protocol:

  • Identify target residues based on:

    • Sequence conservation across species

    • Predicted involvement in ion coordination or transport

    • Structural proximity to putative ion pathways

  • Generate mutations using overlap extension PCR or commercially available mutagenesis kits

  • Clone the mutated genes into expression vectors and transform into appropriate host cells

  • Express and purify the mutant proteins using the approaches outlined for wild-type MrpB

  • Assess functional consequences through:

    • In vitro ion transport assays after reconstitution into proteoliposomes

    • Complementation studies in mrpB-deletion strains

    • Structural analyses to detect conformational changes

For example, researchers studying other B. pseudofirmus proteins have successfully employed the gene SOEing (gene splicing by overlap extension) method using specific primer pairs to generate mutations . This approach could be adapted for MrpB studies.

What techniques are most effective for studying the integration of MrpB into the complete Mrp complex?

Understanding how MrpB integrates into the complete Mrp complex requires specialized approaches:

  • Co-expression and co-purification strategies:

    • Design expression constructs containing multiple Mrp subunits

    • Use affinity tags on different subunits to verify interactions

    • Employ blue-native PAGE to analyze complex formation

  • Cryo-electron microscopy:

    • The complete B. pseudofirmus Mrp complex has been successfully visualized using cryoEM at 2.2 Å resolution

    • Single-particle analysis combined with symmetry expansion and focused 3D refinement enabled high-resolution structure determination

    • Similar approaches could be used to study subcomplexes containing MrpB

  • Cross-linking mass spectrometry:

    • Chemical cross-linking followed by mass spectrometry can identify interaction interfaces

    • Zero-length cross-linkers or photoactivatable cross-linkers can be particularly informative

  • Fluorescence-based approaches:

    • FRET (Förster Resonance Energy Transfer) between labeled subunits can provide dynamic information about subunit interactions

    • Fluorescence microscopy with fluorescently tagged subunits can reveal localization patterns

The dimeric nature of the complete complex (dimer of hetero-heptamers) adds complexity to these studies and should be considered in experimental design.

How do environmental factors affect the function and structure of recombinant MrpB?

As a component of an antiporter complex from an alkaliphilic bacterium, MrpB likely exhibits sensitivity to environmental conditions that should be considered in research:

  • pH dependence:

    • B. pseudofirmus grows optimally under alkaline conditions, with the Mrp complex stabilizing internal pH approximately two units below the external environment

    • Functional assays should be conducted across a range of pH values to determine optimal activity

    • Structural stability may vary with pH and should be assessed using techniques such as circular dichroism or thermal shift assays

  • Sodium concentration effects:

    • The Mrp antiporter exchanges sodium ions for protons

    • Experiments should control and vary sodium concentrations to determine effects on:

      • Protein stability

      • Complex assembly

      • Transport activity

  • Temperature considerations:

    • Expression and purification conditions may need optimization based on temperature

    • Thermal stability assays can reveal the effect of mutations on protein folding

  • Membrane environment:

    • The choice of detergent or lipid environment significantly impacts membrane protein function

    • For the complete Mrp complex, lauryl maltose neopentyl glycol (LMNG) has been successfully used

    • Reconstitution into liposomes of varying lipid composition can reveal lipid-specific effects

What is the stoichiometry of ion exchange in the Mrp antiporter system?

The precise stoichiometry of ion exchange in the B. pseudofirmus Mrp antiporter remains an open question in the field. The available evidence suggests:

  • The antiporter is predicted to be electrogenic, with the number of protons transferred exceeding the number of sodium ions

  • This electrogenicity enables proton uptake against a concentration gradient, driven by the electrical component of the membrane potential (~-180 mV, inside negative)

To determine stoichiometry, researchers could employ:

  • Electrophysiological measurements after reconstitution into planar lipid bilayers

  • pH and sodium ion fluorescence measurements in proteoliposomes

  • Isotope flux assays using radioisotopes (²²Na⁺) to track sodium movement

  • Thermodynamic calculations based on measured membrane potential and ion gradients

Understanding MrpB's specific contribution to this stoichiometry requires careful experimental design, potentially including:

  • Comparison of ion transport rates in complexes with wild-type versus mutated MrpB

  • Analysis of how MrpB mutations affect the electrogenicity of transport

What are the challenges in ensuring proper folding of recombinant MrpB?

Membrane proteins like MrpB present significant challenges for recombinant expression and proper folding. Researchers should consider the following methodological approaches:

  • Expression optimization:

    • Test multiple host strains (E. coli C41, C43, or specialized membrane protein expression hosts)

    • Vary induction conditions (temperature, inducer concentration, duration)

    • Consider fusion partners that enhance folding (such as GFP or MBP)

  • Folding verification methods:

    • Size exclusion chromatography to assess aggregation state

    • Circular dichroism to evaluate secondary structure content

    • Fluorescence-detection size exclusion chromatography (FSEC) for fusion constructs

    • Limited proteolysis to assess compact folding

  • Detergent considerations:

    • Screen multiple detergents for extraction and purification

    • Consider mild detergents that maintain native-like environments

    • LMNG has been successful for the complete Mrp complex

  • Advanced approaches:

    • Cell-free expression systems with supplied lipids or nanodiscs

    • Co-expression with chaperones or other Mrp subunits

    • Directed evolution of expression hosts or the protein itself

How can researchers effectively study protein-protein interactions between MrpB and other Mrp subunits?

Understanding the interactions between MrpB and other Mrp subunits is crucial for elucidating the complex's assembly and function. Recommended methodological approaches include:

  • Co-immunoprecipitation:

    • Express tagged versions of different subunits

    • Precipitate using antibodies against specific tags

    • Identify interacting partners through western blotting or mass spectrometry

  • Surface plasmon resonance (SPR):

    • Immobilize purified MrpB on sensor chips

    • Measure binding kinetics with other purified Mrp subunits

    • Determine affinity constants for various interactions

  • Microscale thermophoresis (MST):

    • Label MrpB with fluorescent tags

    • Titrate with potential interaction partners

    • Measure changes in thermophoretic mobility

  • Native mass spectrometry:

    • Analyze intact complexes and subcomplexes

    • Determine stoichiometry and stability of interactions

    • Identify critical interfaces through hydrogen-deuterium exchange

  • Genetic approaches:

    • Use bacterial two-hybrid or split-protein complementation assays

    • Perform suppressor mutation analysis to identify functional interactions

    • Develop systems similar to those used for tracking all seven Mrp proteins in single samples

What analytical techniques are recommended for assessing the function of recombinant MrpB?

Functional assessment of recombinant MrpB requires specialized techniques to measure ion transport activity:

  • Reconstitution strategies:

    • Incorporate purified MrpB into liposomes

    • Prepare proteoliposomes with defined lipid composition

    • Ensure proper orientation using established protocols

  • Transport assays:

    • Monitor pH changes using pH-sensitive fluorophores

    • Track sodium movement with sodium-sensitive dyes or radioisotopes

    • Perform counter-flow experiments to determine substrate specificity

  • Electrophysiological approaches:

    • Reconstitute MrpB or the complete complex into planar lipid bilayers

    • Measure currents under various ion gradients and membrane potentials

    • Determine ion selectivity through ion substitution experiments

  • Complementation studies:

    • Express recombinant MrpB in mrpB-deletion strains

    • Assess growth under alkaline conditions

    • Measure intracellular pH and sodium levels

  • Structural dynamics:

    • Use EPR spectroscopy with site-directed spin labeling to monitor conformational changes

    • Apply hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

    • Perform molecular dynamics simulations to predict functional movements

How does B. pseudofirmus MrpB compare to homologous proteins in other alkaliphilic bacteria?

Comparative analysis of MrpB across species provides valuable insights into conserved functional elements and species-specific adaptations:

SpeciesSimilarity to B. pseudofirmus MrpBNotable FeaturesReference
Bacillus haloduransHigh similarityAlkaliphilic bacterium with extensive BLASTP hits to B. pseudofirmus proteins
Bacillus clausiiModerate similarityAlkaliphilic with adaptation to high pH
Bacillus sp.Varying degrees of similarityMultiple species show BLASTP hits to B. pseudofirmus proteins

To conduct comparative analyses, researchers should:

  • Perform multiple sequence alignments to identify conserved residues

  • Generate phylogenetic trees to understand evolutionary relationships

  • Compare predicted secondary structure elements

  • Map conserved residues onto available structural models

  • Design chimeric proteins to identify domain-specific functions

How is the Mrp complex related to respiratory complex I?

Mrp-type antiporters are closely related to the membrane domain of respiratory complex I . This evolutionary relationship provides context for MrpB research:

  • Structural similarities:

    • Both complexes exhibit extensive internal hydration, with numerous water molecules in trans-membrane regions

    • Polar sidechains play critical roles in ion translocation pathways

    • Several polar residues are conserved between Mrp antiporters and respiratory complex I

  • Functional relationships:

    • The histidine-switch mechanism identified in Mrp appears to operate in respiratory complex I as well

    • Both complexes involve transmembrane ion translocation coupled to energy conservation

  • Research implications:

    • Findings from MrpB studies may inform understanding of complex I

    • Methodologies developed for one system can often be applied to the other

    • Comparative approaches may reveal fundamental principles of ion translocation

What emerging technologies hold promise for advancing MrpB research?

Several cutting-edge technologies show particular promise for advancing our understanding of MrpB structure and function:

  • Cryo-electron microscopy:

    • Already proven effective for the complete Mrp complex at 2.2 Å resolution

    • Continuing advances may enable visualization of different conformational states

    • Time-resolved cryo-EM could potentially capture transport intermediates

  • Single-molecule techniques:

    • FRET measurements to track conformational changes during transport

    • Force spectroscopy to measure interaction strengths between subunits

    • Single-particle tracking in native membranes

  • Computational approaches:

    • Molecular dynamics simulations to predict ion pathways and binding sites

    • Machine learning for predicting effects of mutations

    • Quantum mechanical calculations for detailed mechanisms of proton transfer

  • Advanced genetic tools:

    • CRISPR-Cas systems adapted for B. pseudofirmus

    • High-throughput mutagenesis and phenotypic screening

    • In vivo crosslinking for capturing transient interactions

What are the key unresolved questions regarding MrpB function and structure?

Despite significant advances, several fundamental questions about MrpB remain unanswered:

  • Precise ion binding sites within MrpB:

    • Which residues directly coordinate sodium ions?

    • How does protonation affect these binding sites?

    • Are there multiple sequential binding sites forming a pathway?

  • Conformational changes during transport:

    • What structural rearrangements does MrpB undergo during the transport cycle?

    • How are these changes coordinated with other subunits?

    • What is the rate-limiting step in the transport process?

  • Subunit interactions:

    • How does MrpB interact with other Mrp subunits at the molecular level?

    • Are there specific lipid requirements for these interactions?

    • How is complex assembly regulated?

  • Physiological regulation:

    • How is MrpB activity regulated in response to environmental changes?

    • Are there post-translational modifications that affect function?

    • Do other cellular components modulate its activity?

Addressing these questions will require integrated approaches combining structural biology, biochemistry, biophysics, and cellular physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.