Recombinant Bacillus pseudofirmus Na (+)/H (+) antiporter subunit C (mrpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary based on the purchasing method and location. For specific delivery timeframes, please contact your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
mrpC; BpOF4_13200; Na(+/H(+ antiporter subunit C; Mrp complex subunit C; Multiple resistance and pH homeostasis protein C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-112
Protein Length
full length protein
Species
Bacillus pseudofirmus (strain OF4)
Target Names
mrpC
Target Protein Sequence
MEILMSITAGVLFMVGTYLILTKSLLRVVVGLILLSHGAHLLLLTMAGLQRGAPPLLHLE ATTYSDPLPQALILTAIVISFGVTSFLLVLAYRTYKEHKTDDLDQLRGSADE
Uniprot No.

Target Background

Function
The Mnh complex is a Na(+)Li(+)/H(+) antiporter involved in Na(+) and/or Li(+) excretion and Na(+) resistance. Na(+)/H(+) antiport consumes a transmembrane electrical potential, and is thus inferred to be electrogenic. It does not transport K(+), Ca(2+) or Mg(2+).
Database Links
Protein Families
CPA3 antiporters (TC 2.A.63) subunit C family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What physiological role does the Mrp antiporter play in Bacillus pseudofirmus?

The Mrp antiporter is essential for B. pseudofirmus to grow under alkaline conditions (pH ~10.5) and in environments with elevated sodium concentrations. Under alkaline conditions, B. pseudofirmus depends on this antiporter to maintain internal pH approximately two units below the external environment . The antiporter facilitates proton accumulation in the cytoplasm while extruding Na+ ions during respiration, contributing to pH homeostasis . This mechanism allows the bacterium to thrive in extreme alkaline environments where most other organisms cannot survive.

How does the Mrp complex relate to respiratory complex I?

The Mrp-type antiporters are closely related to the membrane domain of respiratory complex I, sharing structural and functional similarities . The high-resolution structure of the Mrp antiporter reveals extensive internal hydration patterns similar to those observed in respiratory complex I. Additionally, both complexes utilize similar mechanisms for ion transfer, including the "histidine-switch" mechanism, where a conserved histidine residue (H248 in MrpA) switches position between hydrated pathways to facilitate proton transfer .

What expression systems are most effective for producing recombinant MrpC protein?

For recombinant expression of the Mrp complex components, including MrpC, heterologous expression in E. coli has been successfully employed. The complete B. pseudofirmus Mrp antiporter complex has been recombinantly expressed with a His-tag and purified using affinity chromatography in lauryl maltose neopentyl glycol (LMNG) detergent . For optimal expression of individual subunits like MrpC, considerations must include:

  • Selection of appropriate E. coli strains (BL21(DE3), C41(DE3), C43(DE3)) that better tolerate membrane protein expression

  • Optimization of induction conditions (temperature, IPTG concentration)

  • Use of specialized vectors containing fusion partners to enhance solubility

  • Implementation of mild detergents for extraction and purification

When expressing MrpC independently, researchers should recognize that its stability and proper folding may depend on interactions with other Mrp subunits.

What techniques are most suitable for purifying recombinant MrpC protein?

Purification of recombinant MrpC requires techniques optimized for membrane proteins:

  • Affinity chromatography: Using His-tag or other fusion tags for initial capture

  • Size exclusion chromatography: For further purification and assessment of oligomeric state

  • Ion exchange chromatography: To remove contaminants based on charge differences

The choice of detergent is critical, with LMNG having been successfully used for the entire Mrp complex . For individual subunits like MrpC, screening of various detergents (DDM, OG, CHAPS) is advisable to maintain protein stability and function. Care must be taken to prevent protein aggregation or denaturation during the purification process.

How can researchers functionally reconstitute the Mrp antiporter complex to study MrpC's contributions?

Functional reconstitution of the Mrp antiporter can be achieved by:

  • Purifying the complete Mrp complex or co-expressing all seven subunits

  • Preparing liposomes with appropriate lipid composition

  • Co-reconstituting the Mrp complex with a bacterial F₀F₁-ATPase

  • Using fluorescence-based assays to monitor antiport activity

In this system, proton pumping by the ATPase upon addition of ATP generates a proton motive force that powers the antiporter activity upon subsequent addition of Na+ . To study MrpC's specific contributions, researchers could employ:

  • Reconstitution with MrpC variants (mutations, deletions)

  • Comparison of activity with and without MrpC

  • Crosslinking studies to map interactions between MrpC and other subunits

What structural features distinguish MrpC from other subunits in the Mrp complex?

While the search results do not provide MrpC-specific structural details, general principles for analyzing membrane protein subunits apply. Researchers should examine:

  • Transmembrane topology and arrangement

  • Conserved residues across different bacterial species

  • Potential interaction surfaces with other Mrp subunits

  • Presence of charged or polar residues that might participate in ion translocation

High-resolution structural data of the complete Mrp complex (2.2 Å) provides a foundation for understanding MrpC's position and potential functional role within the complex . Comparative analysis with homologous subunits in related complexes may provide additional insights.

How do conformational changes in the Mrp complex affect MrpC during ion transport?

The Mrp antiporter undergoes conformational changes during ion transport, as indicated by molecular dynamics simulations . While specific MrpC conformational changes are not detailed in the search results, researchers should investigate:

  • Whether MrpC participates in the sodium binding and transfer pathway

  • If MrpC interacts with the key histidine switch (H248) in MrpA

  • How MrpC might contribute to the long-range coupling mechanism between proton uptake and sodium transfer

Understanding these dynamics requires techniques such as:

  • Molecular dynamics simulations with the complete complex

  • FRET-based approaches to monitor conformational changes

  • Crosslinking studies to capture different conformational states

  • EPR spectroscopy to measure distances between key residues during transport

What critical residues in MrpC contribute to Na(+)/H(+) antiport activity?

While the search results do not specifically identify critical residues in MrpC, the identification of such residues would typically involve:

  • Sequence alignment across different species to identify conserved residues

  • Site-directed mutagenesis of conserved charged, polar, or aromatic residues

  • Functional assays to measure antiport activity of mutants

  • Structural analysis to determine the positions of these residues within the complex

The high-resolution structure of the complete Mrp complex provides a basis for predicting potentially important residues in MrpC based on their location within or near ion translocation pathways .

How does MrpC contribute to the ion selectivity of the Mrp antiporter?

Ion selectivity in antiporters often involves specific amino acid arrangements that create binding sites with appropriate size, charge, and coordination geometry. To assess MrpC's contribution to ion selectivity, researchers should:

  • Analyze MrpC for potential ion coordination sites

  • Perform ion competition assays with wild-type and MrpC variants

  • Measure transport rates with different cations (Na+, Li+, K+)

  • Use molecular dynamics simulations to predict ion binding sites

The Mrp complex is known to function primarily as a Na(+)/H(+) antiporter, but it may also transport other cations like Li+ or K+ . Understanding MrpC's role in this selectivity would provide insights into the molecular basis of ion discrimination.

What is the stoichiometry of ion transport in the Mrp antiporter and how might MrpC affect this?

The exact stoichiometry of the Mrp-type antiporters remains unknown but is predicted to be electrogenic, with the number of transferred protons exceeding the number of transferred sodium ions . One proposed model suggests a stoichiometry of 2H+ consumed against one Na+ pumped out . To determine MrpC's influence on this stoichiometry, researchers could:

  • Create MrpC variants through mutagenesis

  • Measure changes in electrogenicity using voltage-sensitive dyes

  • Determine ion transport rates with radioactive tracers

  • Perform thermodynamic analyses to calculate energy coupling efficiencies

How conserved is MrpC across different bacterial species, particularly in alkaliphiles?

MrpC conservation analysis would involve:

  • Comprehensive sequence alignment across diverse bacterial species

  • Phylogenetic analysis to trace evolutionary relationships

  • Structural comparison where available

  • Identification of alkaliphile-specific sequence motifs

The search results indicate that Mrp antiporters are widely distributed in bacteria and are particularly important in halophilic and alkaliphilic bacteria under stress conditions . A related small protein (BpOF4_01690) was identified only in alkaliphiles and plays a critical role in oxidative phosphorylation under highly alkaline conditions , suggesting that certain components may be specifically adapted for alkaline environments.

How does MrpC from Bacillus pseudofirmus compare to homologous subunits in respiratory complex I?

To compare MrpC with homologous subunits in respiratory complex I, researchers should:

  • Identify the corresponding subunit in complex I through sequence and structural alignment

  • Analyze conservation of key residues and structural features

  • Compare functional roles in their respective complexes

  • Examine whether the "histidine-switch" mechanism observed in MrpA/complex I extends to MrpC

The Mrp antiporter is closely related to the membrane domain of respiratory complex I, and several lines of evidence indicate that similar mechanisms operate in both complexes . This evolutionary relationship provides a foundation for comparative analyses.

How can engineered MrpC variants contribute to understanding membrane protein coupling mechanisms?

Engineered MrpC variants could provide valuable insights into:

  • Long-range coupling mechanisms between spatially separated domains

  • Principles of proton-coupled transport

  • Conformational changes during transport cycles

  • Protein-protein interactions within membrane complexes

Specific approaches include:

  • Introduction of reporter groups (fluorescent, spin labels) at strategic positions

  • Creation of cysteine pairs for disulfide crosslinking

  • Design of chimeric proteins with domains from different antiporters

  • Development of constitutively active or inactive variants

What methodological approaches can be used to study MrpC interactions with other Mrp subunits?

Studying protein-protein interactions within membrane complexes requires specialized techniques:

TechniqueInformation ProvidedAdvantagesLimitations
Crosslinking coupled with mass spectrometryIdentification of interaction interfacesCan capture transient interactionsMay introduce artifacts
FRET/BRETReal-time measurement of proximityWorks in native membrane environmentRequires fluorescent labeling
Co-immunoprecipitationVerification of physical associationSimple to implementMay disrupt weak interactions
Bacterial two-hybridIn vivo interaction detectionMaintains membrane environmentFalse positives/negatives
Cryo-EM of subcomplexesStructural characterizationHigh resolution possibleRequires stable complexes

The high-resolution structure (2.2 Å) of the complete Mrp complex already provides a structural framework for understanding these interactions , but these techniques can provide additional dynamic and functional information.

How might understanding MrpC function contribute to biotechnological applications in alkaline environments?

Understanding MrpC function could contribute to:

  • Development of alkaline-tolerant microbial cell factories

  • Engineering of membrane proteins for pH homeostasis in non-native hosts

  • Creation of biosensors for alkaline environments

  • Design of bioremediation strategies for alkaline contaminated sites

The unique properties of the Mrp antiporter that allow B. pseudofirmus to thrive at pH values around 10.5 could be harnessed for various biotechnological applications . MrpC's specific contributions to this alkaline adaptation, once fully characterized, might provide targeted engineering opportunities.

What are the most promising approaches for resolving the specific role of MrpC in the Na(+)/H(+) antiport mechanism?

To advance understanding of MrpC's specific role, researchers should consider:

  • Cryo-EM studies of the complex in different conformational states

  • Time-resolved structural studies during transport

  • Comprehensive mutagenesis coupled with functional assays

  • Advanced MD simulations incorporating protonation state changes

  • Single-molecule techniques to observe conformational dynamics

The existing high-resolution structure and molecular dynamics simulations provide a solid foundation for these future studies .

How can systems biology approaches integrate MrpC function into broader cellular pH homeostasis networks?

Systems biology approaches could include:

  • Genome-scale metabolic modeling incorporating ion transport

  • Transcriptomic/proteomic profiling under varying pH and ion conditions

  • Protein interaction network analysis focused on pH homeostasis proteins

  • Computational modeling of cellular pH and ion gradients

These approaches would help position MrpC and the Mrp antiporter within the broader context of the Na+ cycle in alkaliphilic bacteria , providing a more comprehensive understanding of alkaline adaptation.

What techniques might reveal the precise ion translocation pathway through the MrpC subunit?

Advanced techniques to map ion pathways include:

  • Molecular dynamics simulations with enhanced sampling techniques

  • Electrophysiological studies of reconstituted complexes

  • Neutron diffraction to visualize water and ion positions

  • Time-resolved spectroscopy with ion-sensitive probes

  • Site-directed fluorescence quenching experiments

The high-resolution structure has already enabled identification of water molecules in hydrophobic transmembrane regions, providing clues about potential ion translocation pathways , but MrpC-specific pathways would require targeted investigation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.