Recombinant Bacillus pseudofirmus Na (+)/H (+) antiporter subunit E (mrpE)

Shipped with Ice Packs
In Stock

Description

Structure and Function of MrpE

MrpE is one of the seven subunits (MrpA-MrpG) encoded by the mrp operon . It is essential for the stability and proper function of the Mrp complex. Deletion of mrpE results in the loss of almost all antiport activity, although some residual activity remains, distinguishing it from other deletion mutants .

MrpE and Antiporter Activity

Studies involving site-directed mutations in MrpE have shown that specific residues are critical for Na+/H+ antiport activity . Two mrpE point mutations, T113A and P114G, abolish antiport activity and raise the apparent $$K$$ value of Mrp-dependent Na+/H+ antiporter activity . The P114G mutant, in particular, exhibits greatly reduced antiporter activity, indicating the importance of Proline at position 114 for proper function .

Interactions within the Mrp Complex

MrpE interacts with other subunits of the Mrp complex, and its presence is necessary for the proper assembly of the complex . In the absence of MrpA, MrpB, MrpC, or MrpD, MrpE, MrpF, and MrpG are not observed in the membrane. Every Mrp protein is required for an activity level near that of the wild-type Na+/H+ antiporter, highlighting the importance of MrpE in maintaining optimal antiporter activity .

Functional Motifs and Conserved Residues

Conserved motifs and specific residues within MrpE are crucial for its function. For example, in the related UPF0118 protein, residues such as E179, R182, K215, Q217, D251, R292, R293, E296, K298, and S307 are part of signature functional motifs that determine whether a protein functions as a Na+/H+ antiporter . While these residues are specific to UPF0118, they highlight the importance of conserved residues in the function of Na+/H+ antiporters, suggesting similar importance in MrpE .

Role in pH Homeostasis and Salt Tolerance

Mrp antiporters, including the MrpE subunit, play a vital role in maintaining cytoplasmic pH homeostasis and providing salt tolerance in alkaliphilic bacteria . These antiporters catalyze the active efflux of Na+ in exchange for H+, which is essential for preventing the accumulation of toxic levels of cations and maintaining an appropriate cytoplasmic pH .

Research Findings on MrpE Mutations

MutationEffect on Antiport ActivityEffect on $$K$$ value for Na+
MrpE deletionAlmost complete loss of activityN/A
T113ANo activityN/A
P114GGreatly reduced activityGreatly increased

These findings emphasize the importance of specific residues in MrpE for its function within the Mrp complex .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mrpE; BpOF4_13190; Na(+/H(+ antiporter subunit E; Mrp complex subunit E; Multiple resistance and pH homeostasis protein E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Bacillus pseudofirmus (strain OF4)
Target Names
mrpE
Target Protein Sequence
MAFQILLNLVIAVIWVNFQNSYTAVDFLIGYVVGIFILFVLRRFLRFDFYMRRIWAIIKL ISLFFKELILANIDVIKIVLSPKMNIQPGIVAVPTKLKTDWELSLLASLISLTPGTLSMD FSDDNKYIYIHAIDVPNKEKMIRDIHDTFERAILEVTK
Uniprot No.

Target Background

Function

The Mnh complex is a Na+Li+/H+ antiporter involved in Na+ and/or Li+ excretion and Na+ resistance. Na+/H+ antiport consumes a transmembrane electrical potential and is therefore considered electrogenic. It does not transport K+, Ca2+, or Mg2+. The Mrp complex is a Na+/H+ antiporter involved in Na+ excretion and Na+ resistance.

Database Links
Protein Families
CPA3 antiporters (TC 2.A.63) subunit E family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Mrp antiporter complex and what is known about its structure?

The Mrp (Multiple resistance and pH adaptation) antiporter is a multi-subunit membrane protein complex essential for growth of halophilic and alkaliphilic bacteria under stress conditions. The complex from Bacillus pseudofirmus OF4 consists of seven membrane proteins (MrpA-MrpG) that together facilitate cation/proton antiport. Recent cryo-electron microscopy studies have resolved the structure at 2.2 Å resolution, revealing the arrangement of all seven subunits and identifying water molecules in putative ion translocation pathways . The Mrp antiporter is structurally and functionally related to the membrane domain of respiratory complex I, making it significant for understanding fundamental bioenergetic processes .

What is the specific role of MrpE within the antiporter complex?

MrpE is one of the seven subunit proteins (MrpA-MrpG) required for optimal Na(+)/H(+) antiport activity in the Mrp complex. While earlier studies suggested MrpE might be dispensable, more recent research has shown that all seven proteins, including MrpE, are necessary for activity levels close to that of the wild-type Na(+)/H(+) antiporter . Mutation studies, particularly the MrpE(P114G) substitution, have demonstrated that MrpE plays a critical role in determining substrate affinity, as evidenced by greatly increased apparent Km values for Na+ when this mutation is introduced .

How are recombinant Mrp proteins typically expressed for functional studies?

Recombinant Mrp proteins are typically expressed in antiporter-deficient Escherichia coli strains such as E. coli EP432, which provides a clean background for functional characterization . The expression system must maintain the integrity of the entire mrp operon to ensure proper assembly of the complex. Optimization of expression conditions is critical, as demonstrated by Swartz et al. (2007), who developed improved protocols that yielded higher levels of antiport activity than previously reported . For purification, detergents such as lauryl maltose neopentyl glycol (LMNG) have been successfully used to solubilize the complex while maintaining its structural integrity for subsequent analyses .

What are the recommended assays for measuring Na(+)/H(+) antiport activity in recombinant MrpE studies?

Fluorescence-based assays using pH-sensitive or membrane potential-sensitive probes are the standard methods for measuring Mrp antiport activity. An optimized protocol developed by Swartz et al. for vesicles of antiporter-deficient E. coli EP432 transformants has produced higher levels of secondary Na+(Li+)/H+ antiport than previously reported . The assay protocol typically involves:

  • Preparation of everted membrane vesicles from transformed E. coli cells

  • Establishment of a pH gradient (acidic inside)

  • Monitoring the dissipation of this gradient upon addition of Na+ or Li+ using acridine orange fluorescence

  • Calculation of antiport kinetics parameters such as Km and Vmax

For measuring electrogenicity, a transmembrane electrical potential (ΔΨ) sensitive fluorescent probe can be used to demonstrate that Mrp Na+/H+ antiport is ΔΨ consuming, indicating electrogenic transport .

How can site-directed mutagenesis be used to investigate MrpE function?

Site-directed mutagenesis is a powerful approach for probing MrpE structure-function relationships. The protocol includes:

  • Identification of conserved or functionally important residues through sequence alignment and structural analysis

  • Design of mutagenic primers to generate specific amino acid substitutions

  • PCR-based mutagenesis of the mrpE gene within the context of the entire mrp operon

  • Expression of the mutant construct in an antiporter-deficient host

  • Functional characterization through antiport assays

A notable example is the MrpE(P114G) mutation, which dramatically altered the apparent Km for Na+ without eliminating antiport activity entirely, suggesting its role in substrate binding or conformational changes associated with ion transport .

What approaches are used to study protein-protein interactions within the Mrp complex?

Understanding the assembly and interactions within the Mrp complex requires specialized techniques:

TechniqueApplicationKey Findings for MrpE
Blue native-PAGEAnalysis of membrane protein complexesIdentified two sizes of Mrp complexes containing all seven Mrp proteins
Deletion analysisDetermining subunit requirements for complex formationMrpE, MrpF, and MrpG were not observed in membranes lacking MrpA, MrpB, MrpC, or MrpD
Cross-linking studiesIdentification of neighboring subunitsReveals proximity relationships between MrpE and other subunits
Cryo-electron microscopyHigh-resolution structural analysisResolved positions of all subunits including MrpE at 2.2 Å resolution

This multi-method approach has revealed that a subcomplex of MrpA, MrpB, MrpC, and MrpD can form in the absence of MrpE, MrpF, or MrpG, suggesting a structural core to which the other subunits associate .

How does the absence of MrpE affect the assembly and function of the Mrp complex?

Studies using nonpolar gene deletions have provided important insights into the role of MrpE in complex assembly and function:

  • When MrpE is deleted, a subcomplex consisting of MrpA, MrpB, MrpC, and MrpD can still form, but this complex shows minimal antiport activity .

  • The absence of MrpE allows for complex assembly but results in drastically reduced Na(+)/H(+) antiport activity compared to the wild-type complex, suggesting MrpE is crucial for optimal function rather than essential for basic structural integrity .

  • Functional studies have shown that while every Mrp protein is required for activity levels near that of the wild-type Na(+)/H(+) antiporter, a very low activity level was still detectable in the absence of MrpE .

This evidence suggests MrpE plays a crucial role in optimizing the catalytic efficiency of the antiporter rather than being absolutely essential for minimal function or complex formation.

What insights do molecular dynamics simulations provide about MrpE's functional contribution?

Molecular dynamics (MD) simulations based on high-resolution structures have become invaluable for understanding ion transport mechanisms:

  • MD simulations of the Mrp antiporter from B. pseudofirmus have revealed detailed ion translocation pathways and conformational changes that occur during the transport cycle .

  • For MrpE specifically, simulations can identify potential interactions with neighboring subunits and effects on transmembrane water channels that might influence ion selectivity and transport rates.

  • Simulations have helped identify crucial residues that coordinate sodium ions during transport, potentially including contributions from MrpE that modify the binding environment .

These computational approaches complement experimental studies by providing atomistic insights into transport mechanisms that are difficult to observe directly.

How do researchers reconcile contradictory findings regarding the necessity of MrpE?

Earlier studies suggested MrpE might be dispensable for Mrp function, but more recent research indicates it is required for optimal activity. Reconciling these findings requires careful experimental design and analysis:

  • Standardize expression systems and assay conditions to ensure comparability between studies.

  • Consider that "dispensability" may be context-dependent, varying with bacterial species, growth conditions, or substrate concentrations.

  • Quantitatively assess antiport activity across a range of conditions rather than making binary judgments about functionality.

  • Examine structure-function relationships through complementary approaches (e.g., site-directed mutagenesis, structural studies, and computational modeling).

Recent research has clarified that while a very low level of antiport activity may be detected in the absence of MrpE, the protein is required for activity levels approaching wild-type function .

How can structural information about MrpE inform the development of new antimicrobial strategies?

The Mrp antiporter is essential for survival of many pathogenic bacteria in host environments or stress conditions, making it a potential target for antimicrobial development. Structural knowledge of MrpE can contribute to this effort by:

  • Identifying unique structural features that could be targeted with high specificity.

  • Understanding how MrpE contributes to ion selectivity and transport efficiency, which could guide the design of inhibitors that disrupt these functions.

  • Revealing interactions between MrpE and other subunits that might be disrupted by small molecules.

  • Providing templates for structure-based drug design targeting specific binding pockets or interfacial regions involving MrpE.

With the high-resolution structure of the B. pseudofirmus Mrp complex now available at 2.2 Å resolution , rational design approaches become increasingly feasible.

What experimental designs would best address knowledge gaps in MrpE function?

Several approaches could advance our understanding of MrpE:

  • Systematic alanine scanning mutagenesis of MrpE to identify functionally critical residues beyond the known P114 position.

  • Time-resolved structural studies to capture conformational changes in MrpE during the transport cycle.

  • Development of split Mrp constructs that allow for the incorporation of separately expressed MrpE variants, enabling more flexible manipulation of this subunit.

  • Comparative studies across multiple bacterial species to understand the evolutionary conservation and divergence of MrpE function.

  • Investigation of potential regulatory interactions that might modulate MrpE contribution to antiporter function under different physiological conditions.

These approaches would build upon the foundation established by recent structural and functional studies of the Mrp complex .

How do the properties of recombinant MrpE inform our understanding of respiratory complex I?

The Mrp antiporter is closely related to the membrane domain of respiratory complex I, making insights from MrpE studies relevant to understanding this critical component of energy metabolism:

  • The ion transport mechanisms identified in Mrp studies, including the role of MrpE, may have parallels in complex I function, particularly regarding proton translocation pathways .

  • Molecular dynamics simulations have revealed that switching the position of a histidine residue between three hydrated pathways is critical for proton transfer that drives gated transmembrane sodium translocation, with evidence suggesting this mechanism operates in respiratory complex I as well .

  • Structure-function studies of MrpE may provide insights into how similar subunits in complex I contribute to energy coupling and ion transport.

  • Experimental approaches developed for MrpE studies could be adapted to investigate corresponding components of complex I, potentially advancing our understanding of mitochondrial diseases related to complex I dysfunction.

This cross-fertilization between Mrp and complex I research highlights the broader significance of studying seemingly specialized bacterial systems like the B. pseudofirmus antiporter .

What are the key challenges in expressing and purifying functional recombinant MrpE?

Researchers face several technical challenges when working with MrpE:

  • As a membrane protein, MrpE requires careful handling to maintain its native structure and function.

  • MrpE must be expressed in the context of the entire Mrp complex for proper folding and function, complicating expression and purification strategies.

  • The choice of detergent is critical—lauryl maltose neopentyl glycol (LMNG) has been successfully used for the B. pseudofirmus Mrp complex , but optimization may be required for specific applications.

  • Expression levels and functional activity can vary significantly depending on the host strain and growth conditions, necessitating careful optimization as demonstrated by Swartz et al. .

  • For structural studies, maintaining the integrity of the entire complex during purification is essential, as the structure at 2.2 Å resolution revealed intricate interactions among all seven subunits .

Addressing these challenges requires careful optimization of expression systems, purification protocols, and functional assays specific to the research questions being addressed.

How can researchers differentiate between direct and indirect effects of MrpE mutations?

Distinguishing direct functional impacts from indirect structural effects requires a multi-faceted approach:

  • Combine functional assays with structural assessments to determine if mutations affect activity directly or by disrupting complex assembly.

  • Use complementary biochemical techniques like limited proteolysis or fluorescence spectroscopy to detect conformational changes resulting from mutations.

  • Perform suppressor screens to identify compensatory mutations that might restore function, potentially revealing functional networks.

  • Employ molecular dynamics simulations to predict how specific mutations affect local structure and dynamics before experimental validation.

  • Design conservative mutations (e.g., P→A versus P→G) to assess the sensitivity of specific positions to perturbation.

The MrpE(P114G) mutation study exemplifies this approach, revealing altered kinetic parameters (increased Km for Na+) while still allowing complex formation and residual function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.