Recombinant Bacillus pumilus ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant protein is produced via heterologous expression in E. coli, followed by affinity chromatography using the N-terminal His-tag . Key production parameters include:

ParameterDetailsSource
Gene SourceBacillus pumilus (strain SAFR-032)
Expression VectorNot explicitly stated (standard E. coli expression systems)
YieldQuantitative data not provided (commercial availability implies scalable yield)
Storage-20°C or -80°C (avoid repeated freeze-thaw cycles)

Functional Studies of ATP Synthase

The recombinant protein enables structural and functional analysis of subunit a’s role in proton translocation. For example:

  • Proton Channel Mechanism: Subunit a interacts with subunit b to stabilize the F₀ sector’s proton pathway. Mutagenesis studies in related species (e.g., Bacillus sp. TA2.A1) highlight the importance of charged residues in subunit a for proton translocation .

  • ATP Synthase Regulation: Inhibition of ATP hydrolysis by the ε subunit (via electrostatic interactions) has been observed in Bacillus species, though subunit a’s regulatory role remains under investigation .

Biochemical Assays

The His-tagged protein facilitates:

  • Protein-Protein Interaction Studies: Co-purification with F₀F₁ subunits (e.g., subunits b, c) to study assembly dynamics .

  • Enzymatic Activity Tests: Recombinant F₀ sectors can be reconstituted into liposomes to measure proton-driven ATP synthesis .

Role in ATP Synthase Assembly

  • Subunit Interactions: The F₀F₁ ATP synthase requires coordinated assembly of subunits a, b, c, δ, γ, and ε. Recombinant subunit a is essential for forming the F₀ stator .

  • Species-Specific Features: Bacillus ATP synthases exhibit unique regulatory mechanisms, such as inhibition of ATP hydrolysis in alkaliphilic strains, which may involve subunit a’s proton channel .

Genetic and Functional Insights

  • Operon Structure: The atp operon in Bacillus species (e.g., B. subtilis) encodes nine subunits, with subunit a positioned early in the operon .

  • Metabolic Impact: Deletion of ATP synthase subunits in B. subtilis reduces growth yield and increases acetate production, underscoring the enzyme’s metabolic centrality .

Comparison with Homologous Proteins

FeatureB. pumilus Subunit a (atpB)B. subtilis Subunit aE. coli Subunit a
Residues244244 (conserved across Bacilli)244 (high sequence similarity)
His-TagN-terminal 10xHis-tagNot standardly taggedVaries by construct
Expression SystemE. coliNative or heterologous systemsE. coli or other hosts
Proton TranslocationF₀ sector channelF₀ sector channelF₀ sector channel

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpB; BPUM_3332; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Bacillus pumilus (strain SAFR-032)
Target Names
atpB
Target Protein Sequence
MGHSSKTTEFLGLTFNLSNVLMITIASIIVLLIAVLTTRVLSIRPTKAQNFMEWIVDFVR NIIGSSMDMKTGAPFLALGVTLLMYIFVSNMLGLPFSISVDHNLWWKSPTADPAITMTLA VMVMGLTHYYGVKAKGVKEYTKDYFRPIPLLVPLKIIEEFANTLTLGLRLYGNIFAGEIL LGLLAGLATNFYSQNIALGIIGTLGAIVPMIVWQAFSLFVGTIQAFIFTMLTMVYISHKV SDEH
Uniprot No.

Target Background

Function

Key component of the proton channel; it plays a crucial role in proton translocation across the membrane.

Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of ATP synthase subunit a (atpB) in Bacillus pumilus?

ATP synthase subunit a (atpB) in Bacillus pumilus serves as a critical component of the F0F1 ATP synthase complex, functioning in the membrane-embedded F0 sector. This subunit forms part of the proton channel that facilitates H+ translocation across the membrane, which drives the rotary mechanism of ATP synthesis. In B. pumilus, as a facultative anaerobic bacterium, ATP synthesis and hydrolysis both play important roles in maintaining pH homeostasis and energy balance under varying environmental conditions . The arrangement of ATP synthase genes, including atpB, is likely similar to that observed in other Bacillus species, forming an operon of nine genes coding for the various subunits of the complex .

How does the atpB gene sequence in Bacillus pumilus compare to other Bacillus species?

While specific sequence comparison data for atpB across Bacillus species was not directly available in the search results, research on related species suggests high conservation. Based on studies of B. subtilis, the arrangement of ATP synthase genes in the atp operon is identical to that of Escherichia coli and several other Bacillus species, with the deduced amino acid sequences showing significant similarity to counterparts in other organisms . For B. pumilus specifically, researchers working with this organism would need to perform comparative genomic analyses to determine the precise level of conservation relative to model organisms like B. subtilis.

What are the general characteristics of recombinant Bacillus pumilus ATP synthase proteins?

Recombinant B. pumilus ATP synthase proteins, including subunit a (atpB), typically display characteristics that make them valuable for research and potential biotechnological applications. Like other Bacillus species, B. pumilus proteins often demonstrate reasonable thermostability and pH tolerance, reflecting the organism's adaptability to environmental stresses. As a facultative anaerobe, B. pumilus can utilize both ATP synthesis and hydrolysis mechanisms to maintain cellular homeostasis . When expressed recombinantly, these proteins retain their functional properties while offering the advantage of controlled production and potential for structural or functional modifications.

What expression systems are suitable for producing recombinant B. pumilus atpB?

B. pumilus itself has been developed as an expression platform with significant potential for recombinant protein production. Studies have demonstrated that B. pumilus can be engineered as an efficient expression host using a Production Strain Blueprinting (PSB) strategy, achieving product titers that exceed those of established industrial hosts like B. licheniformis for certain proteins . For atpB specifically, researchers might consider:

Expression SystemAdvantagesChallengesYield Potential
Engineered B. pumilusNative folding environment, potential for high yieldRequires strain optimizationVery high (>100% relative to B. licheniformis for some proteins)
E. coliWell-established protocols, rapid growthPotential folding issues with membrane proteinsModerate
B. subtilisSimilar physiology to B. pumilus, established geneticsMay require codon optimizationHigh (suitable for gram/liter scale)

What role does atpB play in B. pumilus under different environmental stress conditions?

Proteomics analysis of B. pumilus responses indicates that ATP synthesis and hydrolysis mechanisms play crucial roles in adaptation to environmental stresses, particularly in pH homeostasis . Under stress conditions, B. pumilus regulates proteins involved in electron transport and ATP metabolism. For instance, downregulation of NADH dehydrogenase-like protein (YumB) involved in electron transport and nucleotide-binding protein (YvcJ) with ATPase activity has been observed in stress responses, suggesting active modulation of ATP metabolism pathways .

The atpB subunit would be integral to these adaptive responses as part of the proton channel in the F0 sector. Under aerobic conditions, active H+ transport in B. pumilus is integrated with electron transport in the respiratory chain, while anaerobic conditions might favor ATP hydrolysis mechanisms . The dual capability of B. pumilus to utilize both ATP synthesis and hydrolysis pathways provides metabolic flexibility that contributes to its environmental adaptability.

How do mutations in atpB affect the proton-translocation mechanism in B. pumilus ATP synthase?

Mutations in atpB would likely affect the proton-translocation mechanism in B. pumilus ATP synthase in ways similar to those documented in other species, though specific data for B. pumilus mutations was not available in the search results. Based on knowledge of ATP synthase function in related organisms, potential effects include:

  • Alterations in proton channel formation within the F0 sector

  • Modified interaction with other ATP synthase subunits

  • Changes in the efficiency of coupling between proton translocation and ATP synthesis

  • Potential impacts on membrane insertion and protein stability

These effects would manifest as changes in growth characteristics, particularly under conditions requiring oxidative phosphorylation, similar to the phenotypes observed in B. subtilis atp mutants which show decreased growth yields and rates .

What are the structural determinants of atpB that contribute to ATP synthase assembly in B. pumilus?

While specific structural studies of B. pumilus atpB were not available in the search results, insights can be drawn from related Bacillus species where the ATP synthase components share high sequence similarity . The atpB subunit contains transmembrane helices that are critical for:

Researchers investigating the structural determinants of B. pumilus atpB would benefit from comparative analysis with well-characterized ATP synthase structures, followed by site-directed mutagenesis studies to validate the functional significance of conserved residues.

What are the optimal conditions for expressing recombinant B. pumilus atpB in heterologous systems?

Based on studies of B. pumilus as an expression host itself, several factors should be considered when expressing its proteins, including atpB, in heterologous systems:

ParameterRecommended ApproachRationale
Expression SystemB. subtilis or optimized B. pumilus strainsSimilar cellular environment to native conditions
Media CompositionRich media with appropriate carbon sourceSupports high biomass and protein yield
Induction ConditionsControlled induction at mid-log phaseBalances biomass accumulation with protein production
Temperature30-37°C depending on protein stabilityOptimizes folding while maintaining growth rate
pH6.8-7.4Maintains optimal cellular physiology

For membrane proteins like atpB, expression strategies might require modifications to accommodate proper membrane insertion and folding. The Production Strain Blueprinting (PSB) approach demonstrated with B. pumilus suggests that adaptation of established protocols from related species, followed by iterative optimization, can yield significant improvements in recombinant protein production .

How can researchers effectively purify recombinant B. pumilus atpB while maintaining its native conformation?

Purification of membrane proteins like atpB presents significant challenges due to their hydrophobic nature. A methodological approach would include:

  • Membrane fraction isolation: Differential centrifugation followed by membrane solubilization using appropriate detergents (e.g., n-dodecyl β-D-maltoside or digitonin).

  • Affinity chromatography: Utilizing engineered affinity tags (His-tag or Strep-tag) positioned to minimize interference with protein function.

  • Size exclusion chromatography: For further purification and assessment of protein oligomeric state.

  • Functional assessment: ATP hydrolysis assays to confirm that the purified protein retains its native activity.

  • Structural validation: Circular dichroism spectroscopy to verify secondary structure integrity after purification.

For researchers aiming to study atpB in the context of the complete ATP synthase complex, co-expression of multiple subunits followed by blue native PAGE analysis might be more appropriate than attempting to isolate individual subunits.

What genetic engineering approaches are most effective for modifying atpB in B. pumilus?

The CRISPR-Cas9 system has been successfully applied for targeted gene editing in B. pumilus, as demonstrated by studies targeting other genes such as antimicrobial peptide genes (bac and bact) and sporulation sigma factor (sigF) . This approach would be equally applicable to atpB modifications.

A comprehensive genetic engineering strategy for atpB would include:

  • CRISPR-Cas9 targeting: Design of guide RNAs specific to atpB sequences with minimal off-target effects.

  • Homology-directed repair templates: Construction of templates containing desired modifications flanked by homology arms.

  • Transformation protocol optimization: Adaptation of electroporation or natural competence protocols specific to B. pumilus strains.

  • Screening methodologies: Development of phenotypic or genotypic screening approaches to identify successful transformants.

  • Characterization of mutants: Assessment of ATP synthase function, growth characteristics, and stress responses in modified strains.

The success of such approaches in B. pumilus for other targets suggests that similar methodologies would be effective for atpB modifications .

What analytical techniques are most informative for characterizing atpB function in B. pumilus?

A multi-faceted analytical approach would provide comprehensive insights into atpB function:

  • Proteomics analysis: iTRAQ-based proteomics has been successfully applied to B. pumilus to analyze protein expression patterns under different conditions . This approach could identify changes in ATP synthase components and related proteins in response to atpB modifications.

  • Bioenergetic measurements: Oxygen consumption rates, membrane potential measurements, and ATP synthesis assays would provide direct functional assessment of ATP synthase activity.

  • Growth phenotyping: Analysis of growth characteristics under different carbon sources, particularly those requiring oxidative phosphorylation (e.g., succinate), would reveal the physiological impact of atpB modifications .

  • pH homeostasis assessment: Given the role of ATP synthase in maintaining intracellular pH in B. pumilus , measurements of intracellular pH under different environmental conditions would be informative.

  • Comparative expression analysis: Transcriptomic approaches to evaluate how atpB modifications affect expression of other genes involved in energy metabolism and stress responses.

How does B. pumilus atpB differ from homologous proteins in other bacterial species?

While specific comparative data for B. pumilus atpB was not available in the search results, insights can be derived from studies of ATP synthase in related Bacillus species. The arrangement of ATP synthase genes in the atp operon of B. subtilis is identical to that of E. coli and several other Bacillus species, with the deduced amino acid sequences showing significant similarity across organisms .

Key comparative aspects researchers should consider:

  • Sequence conservation: Analysis of conserved domains and species-specific variations in the primary structure.

  • Functional differences: Comparison of ATP synthesis/hydrolysis rates and proton translocation efficiency.

  • Environmental adaptations: Evaluation of how atpB sequence variations correlate with the ecological niches of different bacterial species.

  • Regulatory mechanisms: Analysis of transcriptional and post-translational regulation of atpB expression and function.

This comparative approach would help contextualize B. pumilus atpB within the broader evolution of bacterial bioenergetics and potentially identify unique features related to B. pumilus' environmental adaptability.

What insights can comparative genomics provide about the evolution of atpB in Bacillus species?

Comparative genomics approaches would reveal evolutionary patterns in atpB across Bacillus species. B. pumilus, B. subtilis, and other related species likely share similar gene arrangements in their atp operons , but may exhibit sequence variations reflecting their diverse ecological adaptations.

Potential evolutionary insights include:

  • Identification of highly conserved residues essential for ATP synthase function across all Bacillus species.

  • Detection of species-specific variations potentially associated with adaptation to different environmental niches.

  • Analysis of selection pressures acting on different domains of the atpB protein.

  • Reconstruction of the evolutionary history of ATP synthase components in the Bacillus genus.

Such comparative analyses would contribute to our understanding of how core bioenergetic systems have evolved while maintaining their fundamental functions across diverse bacterial lineages.

How do the biochemical properties of B. pumilus atpB compare to those of model organisms?

The biochemical properties of B. pumilus atpB likely share similarities with those of other Bacillus species while potentially exhibiting unique characteristics related to B. pumilus' environmental adaptability. B. pumilus has been noted for its capacity to use both ATP synthesis and hydrolysis mechanisms for pH homeostasis , suggesting adaptability in its ATP synthase function.

Key biochemical properties researchers should investigate include:

  • pH optimum: Potentially broader than model organisms, reflecting B. pumilus' adaptability to environmental pH changes.

  • Temperature stability: Possibly enhanced thermostability compared to some model organisms.

  • Catalytic efficiency: Comparison of ATP synthesis/hydrolysis rates under standardized conditions.

  • Inhibitor sensitivity: Differential responses to ATP synthase inhibitors compared to model organisms.

These comparative biochemical studies would provide insights into the functional adaptations of B. pumilus ATP synthase related to its ecological niche.

What potential biotechnological applications exist for recombinant B. pumilus atpB?

Recombinant B. pumilus atpB and ATP synthase components have several potential biotechnological applications:

  • Bioenergy applications: Integration into artificial systems for ATP generation or proton gradient utilization.

  • Biosensors: Development of detection systems for proton motive force disrupting compounds.

  • Drug discovery platforms: Screening for compounds targeting bacterial ATP synthases with potential antimicrobial activity.

  • Protein engineering: Using B. pumilus atpB as a template for creating modified ATP synthases with enhanced stability or altered specificity.

The demonstrated capacity of B. pumilus as an expression platform for heterologous proteins further suggests that engineered versions of its ATP synthase components could be efficiently produced for these applications.

How might structural studies of B. pumilus atpB contribute to understanding ATP synthase mechanism?

Structural studies of B. pumilus atpB would contribute significantly to our understanding of ATP synthase mechanisms, particularly in the context of facultative anaerobes that utilize both ATP synthesis and hydrolysis for cellular homeostasis .

Key contributions could include:

  • Identification of structural features associated with bidirectional function (synthesis and hydrolysis).

  • Elucidation of species-specific adaptations in the proton channel structure.

  • Characterization of subunit interfaces that contribute to the efficiency of energy coupling.

  • Mapping of potential regulatory sites that modulate ATP synthase activity in response to environmental changes.

These structural insights would enhance our fundamental understanding of bioenergetic mechanisms while potentially informing the development of antimicrobials targeting bacterial ATP synthases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.