Recombinant Bacillus pumilus Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
mscL; BPUM_3285; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Bacillus pumilus (strain SAFR-032)
Target Names
mscL
Target Protein Sequence
MLKEFREFAVKGNVIDLAVGVIIGGAFGKIVTSLVNDLIMPLVGIIIGGHDFSGLSIKIG SAQILYGSFIQTVIDFLIISFSIFIFIRYLNKLKRKKVEEEEVVETPDQTEVLLTEIRDL LKHQSQSKDVQ
Uniprot No.

Target Background

Function

A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.

Database Links
Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How is mscL expression regulated in Bacillus species?

Based on studies of the related Bacillus subtilis, mscL expression is growth-phase dependent with significant expression levels during logarithmic growth phase. Expression increases approximately 1.5-fold when cells are grown in high-salt environments (1 M NaCl), suggesting osmotic regulation of the gene .

Expression profile of mscL in Bacillus subtilis across growth phases:

Growth PhaseRelative mscL ExpressionEffect of High Salt (1M NaCl)
Log phaseHigh1.5-fold increase
Late logDrastic decreaseDecreased regardless of salt
StationaryVery lowDecreased regardless of salt
SporulationMinimalMinimal

Interestingly, mscL expression falls dramatically beginning in late log phase and drops to very low levels during sporulation, although some mscL-derived products can be detected in developing spores . This expression pattern suggests that mscL primarily functions during active growth phases when cells are most vulnerable to osmotic challenges.

What methods are used to express and purify recombinant Bacillus pumilus mscL?

Recombinant B. pumilus mscL is typically expressed in E. coli expression systems using vectors that incorporate affinity tags for purification. Based on standard protocols for similar mechanosensitive channels, the following methodology is recommended:

  • Gene cloning: The mscL gene (complete coding sequence of 131 amino acids) is amplified from B. pumilus (strain SAFR-032) genomic DNA and inserted into an expression vector with an appropriate tag (typically His-tag) .

  • Expression: Transform the construct into an E. coli expression strain and induce protein production, typically using IPTG for T7 promoter-based systems .

  • Purification: Extract using detergent solubilization of membranes, followed by affinity chromatography using the incorporated tag .

  • Storage: Store the purified protein at -20°C in a buffer containing 50% glycerol. For extended storage, -80°C is recommended. Repeated freeze-thaw cycles should be avoided .

The final product is typically provided as a lyophilized powder or in a Tris-based buffer with 50% glycerol, optimized for protein stability .

How does Bacillus pumilus mscL compare functionally to mscL channels from other bacterial species?

Comparing B. pumilus mscL with homologs from other bacterial species reveals important insights about structural conservation and functional adaptation:

SpeciesSequence Identity to B. pumilusKey Functional DifferencesOsmotic Response Properties
B. subtilisHigh (>90% estimated)Similar expression patternProtects against osmotic downshift during log phase
Roseobacter denitrificansModerate (~60% estimated)Contains 142 amino acids vs. 131 in B. pumilusSimilar channel properties but distinct amino acid composition
E. coli (reference strain)Moderate (~50% estimated)First characterized mscLServes as model system for mechanosensitive channels

The functional differences reflect evolutionary adaptations to specific environmental niches. For example, B. subtilis mscL deletion mutants lose viability and lyse when subjected to a 0.9 M osmotic downshift during log phase growth, but become resistant to this same downshift by early stationary phase . This suggests that B. subtilis (and likely B. pumilus) have alternative mechanisms for osmotic protection that become activated in stationary phase.

When designing comparative studies, it's essential to consider:

  • Growth phase effects on expression and function

  • Specific osmotic challenges relevant to each species' natural environment

  • Potential compensatory mechanisms in each species

What experimental approaches can resolve contradictory data in mscL functional studies?

When facing contradictory results in mscL research, a systematic troubleshooting approach is recommended:

  • Growth phase standardization: Given that mscL expression varies dramatically between log and stationary phases, ensure all experiments use cultures at precisely defined growth stages. Contradictions often arise from comparing results from different growth phases .

  • Patch-clamp protocol optimization: For electrophysiological studies of mscL conductance, standardize:

    • Membrane patch size and preparation

    • Pressure application rates

    • Buffer composition and osmolarity

    • Recording parameters (voltage, sampling rate)

  • Protein preparation consistency: For studies with recombinant protein:

    • Verify protein integrity before each experiment (e.g., SDS-PAGE)

    • Standardize reconstitution methods

    • Verify orientation in artificial membranes or proteoliposomes

    • Maintain consistent protein:lipid ratios

  • Cross-validation with multiple methodologies: When results conflict between different assay types, implement a multi-method approach:

MethodStrengthsLimitationsImplementation Notes
ElectrophysiologyDirect measurement of channel conductanceTechnically challengingUse consistent patch configurations
Osmotic shock survivalPhysiologically relevantIndirect measure of functionStandardize shock magnitude and duration
Fluorescent probe releaseHigh-throughput potentialArtificial systemVerify membrane incorporation
Molecular dynamics simulationStructural insightsComputational approximationsValidate with experimental data

By systematically applying these approaches, researchers can identify whether contradictions stem from methodological variations, genuine biological complexity, or experimental artifacts .

How can site-directed mutagenesis be used to investigate gating mechanisms of Bacillus pumilus mscL?

Site-directed mutagenesis represents a powerful approach to investigate structure-function relationships in B. pumilus mscL. Based on sequence analysis and comparison with better-characterized homologs, key residues can be targeted to understand gating mechanisms:

Recommended mutagenesis workflow:

  • Target selection:

    • Transmembrane domains: Focus on hydrophobic residues within the predicted transmembrane regions that may contribute to channel gating

    • Conserved motifs: Target the GGXXXG motif and other highly conserved regions across bacterial mscL proteins

    • Cytoplasmic domains: Investigate the C-terminal domain's role in channel function

  • Mutation design matrix:

RegionTarget ResiduesMutation TypesExpected Effects
Transmembrane 1Hydrophobic residues in VVGGIIG motifConservative (L→I) and Non-conservative (L→D)Altered gating threshold, conductance changes
Pore-liningResidues facing channel lumenCharge alterationsModified ion selectivity, gating kinetics
Cytoplasmic domainC-terminal residuesTruncations, charge reversalsChanges in adaptation, stability
  • Functional characterization:

    • Patch-clamp analysis of gating pressure thresholds

    • Measurement of channel conductance

    • Assessment of ion selectivity

    • Evaluation of osmotic shock survival

  • Structural validation:

    • Circular dichroism to verify proper folding

    • Cross-linking studies to assess conformational changes

    • Computational modeling to predict structural impacts

This systematic approach allows mapping of the functional contributions of specific residues and domains to channel gating, providing insights into the molecular mechanisms of mechanosensation .

What are the optimal conditions for functional reconstitution of recombinant B. pumilus mscL?

Successful functional reconstitution of recombinant B. pumilus mscL requires careful attention to membrane composition, protein handling, and assay conditions:

  • Protein preparation:

    • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 50% final concentration for storage aliquots

    • Avoid repeated freeze-thaw cycles

  • Liposome preparation:

    • Optimal lipid composition: 7:3 mixture of phosphatidylethanolamine:phosphatidylglycerol to mimic bacterial membrane

    • Alternative composition: Asolectin lipids (soybean extract) can be used for higher stability

    • Lipid hydration: Use buffer matching final recording conditions

  • Reconstitution protocol:

    • Detergent-mediated reconstitution: Solubilize lipids in detergent (typically n-octylglucoside)

    • Add purified mscL at 1:100 to 1:200 protein:lipid ratio

    • Remove detergent via dialysis or Bio-Beads

    • Form unilamellar vesicles by extrusion through 400 nm filters

  • Functional verification:

    • Patch-clamp analysis of proteoliposomes

    • Fluorescent dye release assays upon osmotic downshift

    • Stopped-flow light scattering to measure water permeability

When troubleshooting failed reconstitution, systematically investigate protein denaturation, inappropriate lipid composition, incomplete detergent removal, or improper protein orientation in the membrane .

How should experimental design address the growth-phase dependence of mscL activity?

Given the significant variation in mscL expression across growth phases , experiments must carefully control for these effects:

  • Growth monitoring protocol:

    • Use optical density (OD600) measurements at regular intervals

    • Define precise harvesting points relative to growth curve:

      • Early log phase: OD600 = 0.2-0.3

      • Mid-log phase: OD600 = 0.5-0.6

      • Late log phase: OD600 = 0.8-1.0

      • Early stationary: 30 minutes after growth rate inflection

  • Expression verification:

    • Implement parallel monitoring of mscL expression

    • Options include qRT-PCR, Western blotting, or reporter systems

    • Normalize experimental data to measured expression levels

  • Design matrix for growth-phase experiments:

Growth PhaseOsmotic ChallengeExpected mscL ActivityControl Measurements
Early log0.9M downshiftModerateCell viability, cell morphology
Mid-log0.9M downshiftHighCell viability, cell morphology
Late log0.9M downshiftDecreasingCell viability, cell morphology
Stationary0.9M downshiftMinimalCell viability, cell morphology
  • Standardization approaches:

    • Synchronize cultures using starvation-reinoculation

    • Define media composition precisely

    • Control temperature and aeration parameters rigorously

    • Consider chemostat growth for most precise control

By implementing these controls, researchers can distinguish true experimental effects from artifacts related to growth-phase dependent changes in mscL expression and activity .

How can researchers differentiate between direct mscL effects and secondary cellular responses in osmotic challenge experiments?

Distinguishing direct mscL effects from secondary cellular responses requires a multi-faceted experimental approach:

  • Temporal resolution analysis:

    • Ultra-fast measurements (milliseconds to seconds): Likely direct mscL activity

    • Short-term responses (seconds to minutes): Combination of channel activity and immediate cellular responses

    • Long-term responses (minutes to hours): Predominantly secondary adaptations

  • Genetic approach matrix:

Experimental SystemAdvantagesLimitationsNotes
mscL deletionEliminates direct mscL effectsMay trigger compensatory mechanismsCompare to wild-type in identical conditions
mscL point mutantsAllows specific functional domain analysisMay have partial functionalityUse multiple mutations affecting different properties
ComplementationConfirms phenotype is due to mscLExpression level may differ from wild-typeControl for expression level
Heterologous expressionTests sufficiency of mscLDifferent cellular contextUse minimal native channels
  • Pharmacological approaches:

    • Channel-specific inhibitors (when available)

    • Metabolic inhibitors to block secondary responses

    • Membrane-active compounds as controls

  • Data analysis strategies:

    • Principal component analysis to separate immediate vs. delayed responses

    • Comparative analysis between wild-type and mscL mutants

    • Mathematical modeling to predict direct channel contributions

Research with B. subtilis shows that while log-phase ΔmscL cells rapidly lose viability and lyse upon osmotic downshift, early stationary phase ΔmscL cells become resistant to the same challenge . This demonstrates that secondary mechanisms become important at different growth phases.

What are the emerging applications of recombinant B. pumilus mscL in synthetic biology and biotechnology?

While B. pumilus mscL research is still primarily focused on fundamental mechanisms, several promising applications are emerging:

  • Biosensors and biodevices:

    • Engineered mscL variants as pressure-sensitive components

    • Integration into microfluidic systems for flow detection

    • Coupling to reporter systems for real-time osmotic monitoring

  • Controlled release systems:

    • Engineered proteoliposomes for stimulus-responsive drug delivery

    • Controlled release of encapsulated compounds upon mechanical triggers

    • Cell-based delivery systems using modified mscL

  • Model systems for mechanobiology:

    • Platform for studying fundamental mechanosensation principles

    • Simplified system for testing physical models of membrane deformation

    • Comparative analysis with eukaryotic mechanosensitive channels

Future research directions should focus on:

  • Structural studies: High-resolution structures of B. pumilus mscL in different conformational states

  • Systems biology: Integration of mscL function with global osmotic response networks

  • Synthetic biology: Engineering mscL variants with modified gating properties, selectivity, or regulatory mechanisms

As a model mechanosensitive protein, B. pumilus mscL offers insights into fundamental biophysical principles while providing a platform for biotechnological innovation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.