Recombinant Bacillus pumilus UPF0756 membrane protein BPUM_2558 (BPUM_2558)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement, and we will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
BPUM_2558; UPF0756 membrane protein BPUM_2558
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Bacillus pumilus (strain SAFR-032)
Target Names
BPUM_2558
Target Protein Sequence
MFTQANLFLVLLLVIALIAKNNSLILAVSVLIGIKLIGLDQKIFPVLQSKGINWGVTVIT IAVLVPIATGDIGFKQLGEAVKSSYAWIALGAGILVALIAKNGIVLLENDPHITTALVFG TILAVSLFKGVAVGPLIGAGIAYLAMQAVKFFSG
Uniprot No.

Target Background

Database Links
Protein Families
UPF0756 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are available for producing recombinant BPUM_2558?

Multiple expression systems have been optimized for BPUM_2558 production, each offering advantages for specific research applications:

Expression SystemTypical PurityAvailable TagsPrimary AdvantagesBest Applications
E. coli>90%His, AviTagHigh yield, economicalStructural studies, biochemical assays
Baculovirus>85%VariousImproved foldingFunctional studies requiring complex folding
Yeast>85%VariousPost-translational modificationsStudies requiring eukaryotic processing
Mammalian cell>85%VariousNative-like foldingHighest authenticity functional studies

The E. coli expression system with His-tag is most commonly documented in the literature, offering reliable yields and straightforward purification protocols . For studies where proper membrane protein folding is critical, insect or mammalian expression systems may provide advantages despite typically lower yields .

What is currently known about BPUM_2558's biological function?

The exact biological function of BPUM_2558 remains largely uncharacterized, placing it among the many bacterial membrane proteins with undefined roles. Current hypotheses suggest involvement in:

  • Membrane integrity maintenance - The protein's structure indicates multiple transmembrane domains that may contribute to bacterial membrane organization.

  • Stress response pathways - Proteomic studies of B. pumilus strains (particularly SAFR-032) suggest membrane proteins like BPUM_2558 may participate in environmental adaptation mechanisms including acid resistance and stress tolerance .

  • Potential involvement in bacterial communication - While direct evidence is lacking, membrane proteins in B. pumilus often participate in quorum sensing and cell-cell communication .

While B. pumilus as a species has well-documented applications in biocontrol against fungal phytopathogens and industrial processes (such as vitamin C precursor production), BPUM_2558 itself has not yet been directly linked to these specific pathways . The protein's classification in the UPF0756 family indicates its function remains to be experimentally validated.

How should experiments be designed to investigate BPUM_2558's membrane properties?

When designing experiments to investigate BPUM_2558's membrane properties, follow this structured experimental approach:

  • Define Variables and Hypotheses:

    • Independent variables: BPUM_2558 concentration, lipid composition, environmental conditions (pH, temperature, salt concentration)

    • Dependent variables: Membrane fluidity, permeability, protein localization, ion flux

    • Null hypothesis: BPUM_2558 does not alter membrane properties under tested conditions

    • Alternative hypothesis: BPUM_2558 significantly affects specific membrane properties under defined conditions

  • Methodological Approach:

    • Reconstitution studies: Incorporate purified BPUM_2558 into liposomes of defined composition

    • Fluorescence-based assays: Employ membrane probes (e.g., DPH, Laurdan) to measure fluidity changes

    • Permeability assays: Use fluorescent dyes to monitor membrane permeability

    • Electrophysiology: Apply patch-clamp techniques if ion channel activity is suspected

  • Experimental Design Structure:

    • Implement a between-subjects experimental design comparing:

      • Liposomes without BPUM_2558 (negative control)

      • Liposomes with wild-type BPUM_2558

      • Liposomes with mutant BPUM_2558 variants

      • Liposomes with known membrane-modifying proteins (positive control)

  • Controls and Variables:

    • Control variables: Temperature, buffer composition, lipid:protein ratio

    • Randomization: Randomly assign preparations to measurement conditions

    • Blinding: When possible, blind the analysis phase to prevent bias

  • Data Analysis Plan:

    • Statistical comparison between experimental and control conditions using appropriate tests

    • Dose-response relationships between BPUM_2558 concentration and measured parameters

    • Multiple replicate experiments to ensure reproducibility

This experimental design structure follows established guidelines for membrane protein research while adhering to fundamental principles of scientific methodology.

What approaches should be used to study potential protein-protein interactions involving BPUM_2558?

To investigate protein-protein interactions involving BPUM_2558, implement this comprehensive methodological framework:

  • Interaction Detection Methods:

    • Affinity-based approaches:

      • Co-immunoprecipitation using anti-tag antibodies (anti-His)

      • Pull-down assays with tagged BPUM_2558 as bait

      • Crosslinking followed by mass spectrometry (XL-MS)

    • Proximity-based approaches:

      • Bacterial two-hybrid systems (more suitable for membrane proteins than Y2H)

      • FRET/BRET for real-time interaction monitoring

      • Proximity labeling (BioID, APEX) for in vivo interaction landscape

  • Experimental Design Considerations:

    • Treatment structure: Compare multiple conditions including:

      • Wild-type BPUM_2558 vs. truncated variants

      • Native vs. stress conditions

      • Different bacterial growth phases

    • Controls: Include non-interacting membrane proteins as negative controls

    • Validation strategy: Confirm key interactions using at least two independent methods

  • Membrane Protein-Specific Adaptations:

    • Select mild detergents compatible with maintaining protein-protein interactions

    • Consider membrane microdomains and lipid dependencies

    • Validate interactions in membrane mimetics (nanodiscs, liposomes)

  • Bioinformatic Integration:

    • Predict potential interaction partners using:

      • Co-evolutionary analysis across bacterial species

      • Structural modeling of interaction interfaces

      • Network analysis using existing B. pumilus interactome data

    • Use predictions to guide experimental design

  • Data Analysis Framework:

    • Apply appropriate statistical methods to distinguish specific from non-specific interactions

    • Consider stoichiometry and binding kinetics

    • Integrate data from multiple approaches into interaction models

This approach integrates the principles of experimental design with specialized considerations for membrane protein interaction studies, balancing discovery-based and hypothesis-driven strategies.

How can contradictory findings about BPUM_2558 function be reconciled through systematic analysis?

When encountering contradictory findings about BPUM_2558 function, apply this contextual analysis framework to systematically reconcile discrepancies:

  • Categorize Contextual Variables:
    Organize potential explanatory factors into five main categories:

    • Internal to the organism:

      • Strain differences (e.g., SAFR-032 vs. other B. pumilus strains)

      • Growth phase variations

      • Genetic background differences

    • External to the organism:

      • Media composition and nutrient availability

      • Temperature, pH, and osmolarity conditions

      • Presence of stress factors

    • Methodological differences:

      • Expression systems (E. coli vs. mammalian cells)

      • Tag positions and types

      • Purification and storage methods

    • Experimental design variations:

      • In vitro vs. in vivo approaches

      • Concentration ranges tested

      • Assay sensitivity and specificity

  • Structured Comparison Analysis:

    • Create a tabular comparison of contradictory claims, documenting all experimental conditions

    • Code each study for methodological approach and context

    • Identify patterns that correlate specific outcomes with particular conditions

  • Hypothesis Formulation:

    • Develop context-dependent hypotheses (e.g., "BPUM_2558 exhibits function X under condition Y, but not under condition Z")

    • Consider protein moonlighting possibilities (different functions in different contexts)

    • Formulate testable predictions based on contextual patterns

  • Validation Experimental Design:

    • Design experiments that directly test context-dependency

    • Systematically vary the conditions that differ between contradictory reports

    • Include appropriate controls and replication

    • Employ between-subjects experimental design comparing conditions systematically

This contextual analysis approach follows the methodology outlined in research on biomedical literature contradictions, adapting it specifically to membrane protein functional studies .

What are the optimal storage and handling conditions for maintaining BPUM_2558 stability?

For maximizing BPUM_2558 stability and activity in research applications, follow these evidence-based storage and handling protocols:

  • Long-term Storage Parameters:

    • Lyophilized form: Store at -20°C to -80°C; stable for approximately 12 months

    • Liquid form: Store at -20°C to -80°C; stable for approximately 6 months

    • Storage buffer composition: Tris/PBS-based buffer containing 6% Trehalose, pH 8.0

  • Reconstitution Protocol:

    • Centrifuge vial briefly before opening to collect contents at the bottom

    • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is typically recommended)

    • Aliquot into single-use volumes to prevent repeated freeze-thaw cycles

  • Working Solution Management:

    • Store working aliquots at 4°C for a maximum of one week

    • Avoid repeated freezing and thawing, which significantly compromises protein integrity

    • For experiments requiring dilution, prepare fresh dilutions from stock immediately before use

  • Stability Considerations:

    • Protein stability is influenced by multiple factors:

      • Buffer composition (ionic strength, pH)

      • Temperature fluctuations

      • Presence of stabilizing agents (glycerol, trehalose)

      • Freeze-thaw cycles

    • Consider stability validation before critical experiments using techniques such as thermal shift assays or activity measurements

These recommendations are synthesized from multiple commercial sources of recombinant BPUM_2558 and represent consensus best practices for maintaining protein integrity throughout the research workflow.

What analytical techniques should be used to verify BPUM_2558 purity and integrity?

To comprehensively assess the purity and structural integrity of recombinant BPUM_2558 preparations, implement this multi-technique analytical strategy:

  • Purity Assessment:

    • SDS-PAGE analysis:

      • Run samples under reducing conditions

      • Compare against molecular weight standards

      • Verify single band at expected molecular weight (~17 kDa for full-length)

      • Commercial preparations typically achieve >85-90% purity by this method

    • Size exclusion chromatography (SEC):

      • Evaluate monodispersity and aggregation state

      • Detect potential oligomeric forms

      • Quantify purity by peak area integration

  • Identity Confirmation:

    • Western blotting:

      • Using antibodies against the tag (e.g., anti-His)

      • Using antibodies against BPUM_2558 if available

    • Mass spectrometry approaches:

      • Peptide mass fingerprinting after tryptic digestion

      • Intact mass analysis to confirm molecular weight

      • Sequence coverage analysis to verify primary structure

  • Structural Integrity Analysis:

    • Circular dichroism (CD) spectroscopy:

      • Assess secondary structure composition

      • Monitor structural changes under various conditions

    • Fluorescence spectroscopy:

      • Exploit intrinsic tryptophan fluorescence to monitor tertiary structure

      • Track structural changes during thermal or chemical denaturation

    • Thermal stability assays:

      • Determine melting temperature (Tm)

      • Compare stability across different buffer conditions

  • Functional Verification:

    • Membrane integration assays:

      • Verify incorporation into liposomes

      • Assess orientation in membrane mimetics

    • Activity assays:

      • If specific activity is known, verify function

      • If not, assess general properties expected of membrane proteins

This analytical framework provides complementary approaches to verify both the physical quality and biological relevance of BPUM_2558 preparations for research applications.

How should researchers approach functional characterization of an uncharacterized protein like BPUM_2558?

For systematic functional characterization of BPUM_2558, implement this multi-faceted research strategy that integrates bioinformatic, biochemical, and genetic approaches:

  • Computational Functional Prediction:

    • Sequence-based analysis:

      • Identify conserved domains and motifs

      • Perform phylogenetic profiling across bacterial species

      • Apply machine learning tools trained on characterized membrane proteins

    • Structural prediction:

      • Generate 3D models using AlphaFold or similar tools

      • Identify potential binding pockets or functional sites

      • Compare structural features with characterized membrane proteins

    • Genomic context analysis:

      • Analyze gene neighborhood in B. pumilus genome

      • Identify co-expression patterns

      • Examine operonic organization

  • Expression Pattern Analysis:

    • Condition-dependent expression:

      • Quantify BPUM_2558 expression under various stress conditions

      • Monitor expression during different growth phases

      • Compare expression across various nutrient conditions

    • Experimental design approach:

      • Use qRT-PCR or RNA-seq for transcript quantification

      • Apply Western blotting for protein-level verification

      • Design between-subjects comparisons across conditions

  • Genetic Manipulation Studies:

    • Loss-of-function approach:

      • Generate BPUM_2558 knockout or knockdown strains

      • Characterize phenotypes under various conditions

      • Perform complementation studies to confirm specificity

    • Gain-of-function approach:

      • Overexpress BPUM_2558 in B. pumilus

      • Express in heterologous systems

      • Analyze resulting phenotypic changes

  • Biochemical Characterization:

    • Membrane localization:

      • Confirm membrane integration using fractionation

      • Determine topology using accessibility studies

      • Examine association with specific membrane domains

    • Interaction partners:

      • Identify protein-protein interactions (as outlined in question 2.2)

      • Screen for potential ligands or substrates

      • Investigate lipid interactions

  • Physiological Context Investigation:

    • Connect to B. pumilus biology:

      • Test involvement in known B. pumilus processes (e.g., stress response, biocontrol)

      • Examine role in bacterial membrane dynamics

      • Investigate contribution to environmental adaptation

This comprehensive approach follows established experimental design principles while accommodating the specific challenges of characterizing an uncharacterized membrane protein.

How can BPUM_2558 research contribute to understanding bacterial membrane biology?

BPUM_2558 research offers several valuable contributions to the broader understanding of bacterial membrane biology:

  • Model System for UPF0756 Family Characterization:

    • BPUM_2558 serves as a representative of the uncharacterized UPF0756 protein family

    • Functional insights could illuminate roles of homologous proteins across bacterial species

    • Structure-function relationships may reveal conserved mechanisms in bacterial membrane organization

  • Insights into Bacillus Species Stress Adaptation:

    • B. pumilus exhibits remarkable environmental resilience, including radiation and desiccation tolerance

    • Membrane proteins like BPUM_2558 likely contribute to this adaptability

    • Understanding these mechanisms could illuminate bacterial stress response pathways

    • Comparative studies with other Bacillus species could reveal species-specific adaptations

  • Methodological Advances in Membrane Protein Research:

    • Experimental approaches optimized for BPUM_2558 could benefit research on other challenging membrane proteins

    • Novel reconstitution systems or analytical techniques may have broader applications

    • Resolution of contradictory findings through contextual analysis provides a framework for similar challenges

  • Bacterial Membrane Architecture Understanding:

    • BPUM_2558's multiple transmembrane domains suggest potential roles in:

      • Membrane organization and microdomain formation

      • Lipid-protein interactions affecting membrane properties

      • Coordination between membrane components during stress response

  • Applied Research Connections:

    • B. pumilus is employed in industrial and agricultural contexts, including:

      • Biocontrol against fungal phytopathogens

      • Involvement in industrial fermentation processes

      • Potential probiotic applications

    • Understanding membrane proteins like BPUM_2558 could enhance these applications through improved strain engineering

This research directly connects to fundamental questions in bacterial membrane biology while offering potential practical applications in biotechnology and agriculture.

What statistical approaches are most appropriate for analyzing BPUM_2558 functional data?

For robust statistical analysis of BPUM_2558 functional data, implement these methodological approaches tailored to specific experimental designs:

  • Experimental Design-Specific Statistical Methods:

    • Between-subjects designs:

      • Independent samples t-test for two-group comparisons

      • One-way ANOVA for multiple group comparisons with post-hoc tests (Tukey's HSD, Bonferroni)

      • Non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) when normality assumptions are violated

    • Within-subjects designs:

      • Paired t-tests for two-condition comparisons

      • Repeated measures ANOVA for multiple conditions

      • Mixed-effects models for complex designs with both between and within factors

  • Membrane Biology-Specific Analyses:

    • Dose-response relationships:

      • Fit concentration-dependent data to appropriate models:

        • Simple binding: Y=Bmax×XKd+XY = \frac{B_{max} \times X}{K_d + X}

        • Cooperative binding: Y=Bmax×XhKdh+XhY = \frac{B_{max} \times X^h}{K_d^h + X^h}

      • Use non-linear regression with proper weighting

      • Report confidence intervals for key parameters (Kd, Bmax)

    • Time-course data:

      • Apply appropriate kinetic models

      • Use area under curve (AUC) analysis

      • Consider time-series statistical approaches

  • Multi-parameter Data Integration:

    • Principal Component Analysis (PCA):

      • Reduce dimensionality of complex datasets

      • Identify major sources of variation

      • Visualize relationships between samples

    • Hierarchical clustering:

      • Group conditions based on similarity

      • Identify patterns across multiple measurements

      • Generate heat maps for visualization

  • Statistical Validation Strategies:

    • Power analysis:

      • Determine appropriate sample sizes before experimentation

      • Consider effect size, desired power (typically 0.8), and significance level

    • Multiple testing correction:

      • Apply methods like Benjamini-Hochberg for false discovery rate control

      • Use family-wise error rate methods (Bonferroni) when appropriate

    • Cross-validation:

      • Split-sample validation for predictive models

      • Bootstrap methods for robust parameter estimation

  • Reproducibility Considerations:

    • Report effect sizes alongside p-values

    • Provide raw data where possible

    • Clearly document all data transformations and outlier handling

    • Consider pre-registration of analysis plans for confirmatory studies

This statistical framework integrates general principles of experimental design with specific considerations for membrane protein functional studies, emphasizing both statistical rigor and biological relevance.

How can researchers troubleshoot common issues when working with BPUM_2558?

When encountering challenges in BPUM_2558 research, apply this systematic troubleshooting framework addressing common issues:

  • Low Protein Yield Issues:

    • Problem: Poor expression or recovery of recombinant BPUM_2558

    • Diagnostic steps:

      • Verify expression construct integrity by sequencing

      • Check expression conditions (temperature, induction timing)

      • Evaluate cell lysis efficiency

    • Solutions:

      • Optimize codon usage for expression host

      • Test alternative tags or tag positions

      • Evaluate different expression systems (E. coli → insect → mammalian)

      • Consider fusion partners that enhance membrane protein expression

  • Protein Instability Challenges:

    • Problem: Rapid degradation or aggregation of purified BPUM_2558

    • Diagnostic steps:

      • Monitor stability over time using SDS-PAGE

      • Assess aggregation using dynamic light scattering

      • Test thermal stability in different buffers

    • Solutions:

      • Optimize buffer conditions (pH, salt, additives)

      • Include protease inhibitors throughout purification

      • Add stabilizing agents (glycerol, specific lipids)

      • Process samples at lower temperatures

      • Minimize freeze-thaw cycles

  • Functional Assay Inconsistencies:

    • Problem: Variable or unreproducible results in functional studies

    • Diagnostic steps:

      • Verify protein quality before each experiment

      • Review experimental variables systematically

      • Assess assay sensitivity and specificity

    • Solutions:

      • Standardize protein handling procedures

      • Include positive and negative controls in each experiment

      • Implement blinded analysis where possible

      • Increase biological and technical replicates

      • Consider between-subjects experimental design to control variability

  • Membrane Reconstitution Difficulties:

    • Problem: Poor incorporation into membrane mimetics or liposomes

    • Diagnostic steps:

      • Verify protein integrity before reconstitution

      • Assess lipid quality and composition

      • Monitor reconstitution efficiency

    • Solutions:

      • Optimize detergent:lipid:protein ratios

      • Test different reconstitution methods (direct incorporation, detergent removal)

      • Vary lipid composition to better mimic bacterial membranes

      • Consider nanodisc systems for challenging membrane proteins

  • Contradictory Results Resolution:

    • Problem: Findings that contradict published literature or previous experiments

    • Diagnostic steps:

      • Catalog all experimental differences systematically

      • Review reagent sources and batches

      • Analyze raw data for anomalies

    • Solutions:

      • Apply contextual analysis framework (see question 2.3)

      • Design bridging experiments to test context-dependency

      • Consult with experts on specific technical aspects

      • Consider independent replication in different laboratory

This troubleshooting guide integrates technical aspects of membrane protein biochemistry with experimental design principles to address the full spectrum of challenges researchers may encounter with BPUM_2558.

What emerging technologies could advance BPUM_2558 functional characterization?

Several cutting-edge technologies offer promising approaches to advance BPUM_2558 functional characterization:

  • Advanced Structural Biology Methods:

    • Cryo-electron microscopy:

      • Single-particle analysis for high-resolution structure determination

      • Visualization of BPUM_2558 in native-like membrane environments

      • Potential to capture different conformational states

    • Integrative structural approaches:

      • Combining X-ray crystallography, NMR, and computational models

      • Hydrogen-deuterium exchange mass spectrometry for dynamics

      • Cross-linking mass spectrometry for interaction interfaces

  • Genome Editing Technologies:

    • CRISPR-Cas systems adapted for B. pumilus:

      • Precise gene knockout and knockin studies

      • Tagging of endogenous BPUM_2558 for localization studies

      • Creation of conditional expression systems

    • Base editing and prime editing:

      • Introduction of specific amino acid substitutions

      • Creation of point mutation libraries for structure-function analysis

  • Advanced Imaging Technologies:

    • Super-resolution microscopy:

      • Visualization of BPUM_2558 localization with nanometer precision

      • Tracking dynamic behavior in living bacteria

      • Colocalization with other membrane components

    • Correlative light and electron microscopy (CLEM):

      • Linking functional observations with ultrastructural context

      • Visualization of BPUM_2558 in the context of membrane architecture

  • High-throughput Functional Screening:

    • Deep mutational scanning:

      • Systematic assessment of thousands of BPUM_2558 variants

      • Linking sequence variations to functional outcomes

      • Identification of critical residues and domains

    • Microfluidic approaches:

      • Single-cell analysis of BPUM_2558 function

      • Rapid testing of multiple conditions in parallel

      • Droplet-based assays for high-throughput screening

  • Systems Biology Integration:

    • Multi-omics approaches:

      • Integrating transcriptomics, proteomics, and metabolomics

      • Mapping BPUM_2558 within broader cellular networks

      • Identifying condition-specific functional contexts

    • Mathematical modeling:

      • Predicting BPUM_2558 function within cellular systems

      • Simulating effects of perturbations

      • Generating testable hypotheses for experimental validation

These emerging technologies provide complementary approaches to overcome current limitations in BPUM_2558 research, potentially accelerating functional characterization while providing deeper mechanistic insights.

How can researchers design experiments to elucidate BPUM_2558's role in bacterial stress response?

To systematically investigate BPUM_2558's potential role in bacterial stress response, implement this comprehensive experimental design strategy:

  • Expression Analysis Under Stress Conditions:

    • Research Question: Does BPUM_2558 expression change under stress conditions?

    • Experimental Design:

      • Independent variables: Various stress conditions (pH extremes, temperature shock, oxidative stress, osmotic stress, nutrient limitation)

      • Dependent variables: BPUM_2558 mRNA and protein levels

      • Controls: Housekeeping genes, known stress-responsive genes

      • Between-subjects design: Compare multiple stress conditions

    • Methodological Approach:

      • qRT-PCR for transcript quantification

      • Western blotting for protein level analysis

      • Promoter-reporter fusions for dynamic monitoring

  • Genetic Manipulation Studies:

    • Research Question: Does BPUM_2558 deletion or overexpression affect stress tolerance?

    • Experimental Design:

      • Independent variables: Genetic background (wild-type, ΔBPUM_2558, BPUM_2558 overexpression)

      • Dependent variables: Growth parameters, survival rates, membrane integrity

      • Between-subjects comparison: Multiple strains under identical conditions

    • Methodological Approach:

      • Growth curve analysis under stress conditions

      • Survival assays after acute stress exposure

      • Membrane integrity assessment using fluorescent dyes

      • Complementation studies to confirm specificity

  • Protein Localization and Dynamics:

    • Research Question: Does BPUM_2558 relocalize or change interaction partners during stress?

    • Experimental Design:

      • Independent variables: Normal vs. stress conditions

      • Dependent variables: Protein localization, interaction partners

      • Within-subjects design: Track changes in the same samples over time

    • Methodological Approach:

      • Fluorescent protein fusions for localization

      • FRAP (Fluorescence Recovery After Photobleaching) for mobility

      • Proximity labeling for stress-specific interaction mapping

      • Live-cell imaging during stress application

  • Membrane Property Analysis:

    • Research Question: Does BPUM_2558 affect membrane properties during stress?

    • Experimental Design:

      • Independent variables: Genetic background, stress conditions

      • Dependent variables: Membrane fluidity, permeability, composition

      • Factorial design: Examine interaction between genetic background and stress

    • Methodological Approach:

      • Fluorescence anisotropy for membrane fluidity

      • Leakage assays for permeability

      • Lipidomics for composition analysis

      • Atomic force microscopy for mechanical properties

  • Comparative Analysis Across Bacterial Species:

    • Research Question: Is the stress response role of BPUM_2558 conserved in related bacteria?

    • Experimental Design:

      • Independent variables: Bacterial species with BPUM_2558 homologs

      • Dependent variables: Stress phenotypes, protein function

      • Between-subjects comparison: Multiple species under identical conditions

    • Methodological Approach:

      • Heterologous expression studies

      • Complementation across species

      • Phenotypic comparison of knockout mutants

      • Phylogenetic analysis correlated with functional data

This experimental design strategy integrates multiple approaches at different biological levels (gene, protein, cell, population) while following rigorous experimental design principles to establish causality and mechanism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.