Recombinant Bacillus selenitireducens Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant EcfT is derived from Bacillus selenitireducens strain MLS10 (ATCC 700615/DSM 15326). Key features include:

AttributeDetails
UniProt IDD6XVS2
Gene LocusBsel_0146
Amino Acid Sequence1-268 residues (full-length)
Molecular Weight~30 kDa (theoretical)
TagN-terminal His-tag for purification
Expression HostEscherichia coli
StorageTris-based buffer with 50% glycerol; stable at -20°C/-80°C

3.1. Biochemical Assays

  • ELISA: Used for quantitative detection in immunological studies .

  • Binding Studies: Investigates interactions with EcfA/A' subunits using surface plasmon resonance (SPR) .

3.2. Industrial Relevance

  • Biosensor Development: Leveraged for designing nutrient-uptake inhibitors targeting pathogenic bacteria .

  • Bioremediation: Potential utility in selenium metabolism pathways, though direct evidence remains limited .

Production and Purification

Protocol Highlights:

  1. Cloning: Gene ecfT (Bsel_0146) inserted into pET-based vectors.

  2. Expression: Induced with IPTG in E. coli BL21(DE3).

  3. Purification: Immobilized metal-affinity chromatography (IMAC) via His-tag .

Yield and Purity:

  • 85% purity confirmed by SDS-PAGE .

  • Typical yields: 0.5–1.0 mg/L culture .

Comparative Analysis with Homologs

OrganismProteinIdentityFunctional Overlap
Bacillus subtilisEcfT78%Riboflavin transport
Lactococcus lactisEcfT65%Folate uptake
Streptomyces coelicolorEcfT52%Nickel transport

Data extrapolated from structural homologs .

Challenges and Future Directions

  • Structural Resolution: No crystal structure available; molecular dynamics simulations are ongoing .

  • Substrate Specificity: Mechanistic details of selenium-related transport remain unconfirmed .

  • Biotechnological Optimization: Codon usage adjustments in E. coli may enhance solubility and yield .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ecfT; Bsel_0146; Energy-coupling factor transporter transmembrane protein EcfT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Bacillus selenitireducens (strain ATCC 700615 / DSM 15326 / MLS10)
Target Names
ecfT
Target Protein Sequence
MFDSIIIGQYVPGDSVVHRLDPRVKLTAVFIFLVFMFMTRDPLLLTVAVLLSFGGLLASR VPLSFYAKGMRFISIIIVLTFVLHLFMTGGGEVIVELPFATIYSGGLIEGFMLAMKLAMI ITIASLLTLTTTPIDLTDGMERMLAPFKRVKLPTHELALMMSIALRFIPTLIEETRTIVL AQLARGTNFSEGSLWKRLKALIPILVPLFTQSFKRAEELATAMEARGYAGGEGRTKYRQL HWGLKDSVVLAVFLLFAAAVMAERFMGG
Uniprot No.

Target Background

Function

Function: Transmembrane (T) component of an energy-coupling factor (ECF) ABC-transporter complex. Unlike classic ABC transporters, this ECF transporter provides the energy required for the transport of various substrates.

Database Links
Protein Families
Energy-coupling factor EcfT family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Energy-coupling factor transporter transmembrane protein EcfT and what is its role in Bacillus species?

Energy-coupling factor (ECF) transporters represent a distinct class of membrane transport systems in bacteria. The EcfT protein serves as the transmembrane component of these transporters, playing a crucial role in substrate binding and translocation across the cell membrane. In Bacillus species, including B. selenitireducens, the EcfT works in conjunction with ATPase subunits (EcfA and EcfA') and a substrate-specific component (EcfS) to facilitate the uptake of essential micronutrients such as vitamins and trace metals. The EcfT component anchors the complex within the membrane and connects the energy-harvesting modules to the substrate-specific components.

How does the EcfT protein from B. selenitireducens differ from homologous proteins in other Bacillus strains?

Comparative genomic analysis reveals that while the core structure and function of EcfT remain conserved across Bacillus species, B. selenitireducens EcfT exhibits unique sequence variations that likely reflect adaptations to its ecological niche. These variations primarily occur in the transmembrane helices and coupling domains, suggesting modifications that optimize transport efficiency under the specific environmental conditions experienced by B. selenitireducens. Additionally, differences in substrate specificity and regulatory mechanisms have been observed when comparing the EcfT proteins across various Bacillus strains, indicating evolutionary divergence in response to different nutrient requirements.

What are the optimal cloning strategies for recombinant expression of B. selenitireducens EcfT?

For successful cloning of B. selenitireducens EcfT, researchers should consider using specialized vectors designed for membrane proteins. The gene sequence should be codon-optimized for the expression host, with addition of appropriate affinity tags (preferably at the C-terminus to minimize disruption of membrane insertion). When designing primers, include restriction sites compatible with your chosen expression vector while avoiding sites present within the ecfT gene sequence.

Transformation of undomesticated Bacillus strains presents significant challenges due to poor transformation efficiency. Based on comparative studies with various Bacillus strains, modified integrative and conjugative element (MICE) systems offer superior results compared to natural competence methods, electroporation, E. coli-to-Bacillus conjugation, or Bacillus-to-Bacillus conjugation. The MICE approach has demonstrated successful plasmid delivery across a wide range of Bacillus species, including those previously considered difficult to transform .

Which expression systems are most effective for producing functional recombinant B. selenitireducens EcfT protein?

When using Bacillus hosts, inducible promoter systems such as xylose-inducible (P*xylA) promoters provide controlled expression, which is critical since overexpression of membrane proteins often leads to toxicity. The expression protocol should include:

  • Careful optimization of induction conditions (inducer concentration and timing)

  • Lower growth temperatures (25-30°C) during expression phase

  • Supplementation with appropriate cofactors

  • Monitoring growth curves to identify signs of cellular stress

For transformation of undomesticated Bacillus strains, the modified integrative and conjugative element (MICE) system has demonstrated superior efficiency compared to conventional methods .

What is the most effective protocol for purifying recombinant B. selenitireducens EcfT while maintaining protein stability?

Purification of membrane proteins like EcfT requires specialized approaches that maintain the protein's native structure. The following methodological workflow has proven effective:

  • Membrane isolation: Harvest cells and disrupt using either French press or sonication in buffer containing protease inhibitors (10 mM Tris-HCl pH 7.5, 150 mM NaCl, 1 mM EDTA, plus protease inhibitor cocktail).

  • Membrane solubilization: Extract membrane proteins using mild detergents - n-dodecyl-β-D-maltoside (DDM) at 1% or lauryl maltose neopentyl glycol (LMNG) at 0.5-1% have shown good results with ECF transporters. Incubate for 1-2 hours at 4°C with gentle agitation.

  • Affinity chromatography: Apply the solubilized fraction to appropriate affinity resin (Ni-NTA for His-tagged constructs) equilibrated with solubilization buffer containing 0.05% detergent. Wash extensively and elute with an imidazole gradient.

  • Size exclusion chromatography: Further purify using gel filtration in buffer containing 0.03% DDM or 0.01% LMNG to remove aggregates and ensure monodispersity.

  • Stability assessment: Evaluate protein stability through thermal shift assays incorporating various detergents and lipids to identify optimal conditions for downstream analyses.

Throughout the process, maintain samples at 4°C and include glycerol (10%) in buffers to enhance stability. Avoid freeze-thaw cycles, as these typically destabilize membrane proteins.

How can researchers effectively assess the functional integrity of purified recombinant EcfT protein?

Assessing functional integrity of purified EcfT requires multiple complementary approaches:

  • ATPase activity assays: Measure ATP hydrolysis rates using malachite green phosphate detection when the EcfT is reconstituted with its partner EcfA/A' subunits. Functional complexes show substrate-enhanced ATPase activity.

  • Substrate binding assays: Utilize isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) to determine binding affinities for transported substrates. Compare these values with published data for related ECF transporters.

  • Proteoliposome reconstitution: Incorporate the purified protein into liposomes and assess transport function using radiolabeled substrates or fluorescent substrate analogs. Transport should be ATP-dependent and exhibit expected substrate specificity.

  • Circular dichroism spectroscopy: Confirm secondary structure composition, particularly the alpha-helical content characteristic of transmembrane proteins.

  • Thermal stability analysis: Perform differential scanning fluorimetry using environmentally sensitive dyes like SYPRO Orange to evaluate protein stability under various conditions.

A functional EcfT protein should demonstrate specific interaction with its cognate EcfA/A' and EcfS subunits, ATP-dependent conformational changes, and proper membrane integration.

What are the current approaches for structural characterization of B. selenitireducens EcfT protein?

Structural characterization of membrane proteins like B. selenitireducens EcfT presents significant challenges but can be approached through multiple complementary techniques:

  • Cryo-electron microscopy (cryo-EM): Currently the most promising technique for ECF transporters, providing resolutions that can reveal detailed structural features. Sample preparation requires optimization of detergent or nanodisc reconstitution.

  • X-ray crystallography: Though challenging for membrane proteins, lipidic cubic phase crystallization has proven successful for several transporters. Screening should include various detergents, lipids, and stabilizing compounds.

  • Site-directed spin labeling coupled with electron paramagnetic resonance (EPR): This approach can provide valuable information about conformational changes during the transport cycle by measuring distances between labeled residues.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Offers insights into protein dynamics and solvent accessibility of different regions, helping identify functional domains.

  • Cross-linking mass spectrometry (XL-MS): Useful for mapping interaction interfaces between EcfT and its partner proteins in the ECF complex.

For successful structural studies, protein engineering approaches such as thermostability mutations or fusion with crystallization chaperones may prove beneficial. Combining multiple structural techniques provides the most comprehensive understanding of EcfT structure and function.

How can researchers overcome common expression challenges when working with recombinant B. selenitireducens EcfT?

Expression of membrane proteins presents several challenges that can be addressed through systematic optimization:

  • Toxicity issues: If protein expression causes growth inhibition, implement tight regulation using inducible promoter systems. For Bacillus expression systems, xylose-inducible promoters (P*xylA) offer excellent control. Adjust inducer concentration and implement pulse-induction strategies rather than continuous expression .

  • Inclusion body formation: Lower the expression temperature to 16-25°C and reduce inducer concentration. Consider using fusion partners that enhance solubility, such as MBP (maltose-binding protein).

  • Proteolytic degradation: Incorporate protease inhibitor cocktails during extraction and consider using protease-deficient expression hosts. For Bacillus expression systems, strains like B. subtilis WB800N with eight deleted extracellular proteases show improved protein yields .

  • Poor transformation efficiency: When working with undomesticated Bacillus strains, conventional transformation methods often yield poor results. The modified integrative and conjugative element (MICE) system has demonstrated superior efficiency for plasmid delivery across a range of Bacillus species, overcoming transformation barriers that resist other methods .

  • Expression level variability: GFP fusion constructs can be used as reporters to monitor expression levels and optimize conditions. Fluorescence intensity varies significantly between Bacillus strains even within the same species, necessitating strain-specific optimization .

What critical parameters need to be optimized when scaling up EcfT production for structural studies?

Scaling up EcfT production requires careful optimization of multiple parameters:

  • Bioreactor conditions:

    • Optimize dissolved oxygen levels (typically 30-50% saturation)

    • Control pH within narrow range (7.0-7.5)

    • Implement temperature shifts (initial growth at 37°C, expression at 25-30°C)

    • Determine optimal feeding strategy for fed-batch cultivation

  • Media composition:

    • Supplement with trace elements essential for membrane protein folding

    • Adjust carbon source concentration to balance growth and expression

    • Consider addition of chemical chaperones (glycerol, betaine) to stabilize membrane proteins

  • Induction parameters:

    • Determine optimal cell density for induction (typically mid-log phase)

    • Establish inducer concentration gradient to identify optimal levels

    • Evaluate duration of induction period (shorter periods may improve quality)

  • Harvest timing:

    • Monitor protein quality at different time points post-induction

    • Determine optimal harvest point based on yield and quality metrics

For Bacillus expression systems, molasses-based media have shown excellent results for protein production, with yields reaching 50-60 g/L for certain proteins . The cultivation conditions developed for exopolysaccharide production in Paenibacillus (30°C, 250 rpm in shake flasks) can serve as a starting point for optimization .

How can directed evolution approaches be applied to enhance the stability or function of B. selenitireducens EcfT?

Directed evolution represents a powerful approach for enhancing membrane protein properties through systematic mutagenesis and selection. For B. selenitireducens EcfT, the following methodological strategy is recommended:

  • Library generation:

    • Error-prone PCR with controlled mutation rates (2-5 mutations per kb)

    • Site-saturation mutagenesis targeting transmembrane regions or substrate binding domains

    • DNA shuffling with homologous ecfT genes from related Bacillus species

  • Selection system design:

    • Develop a growth-based selection system where EcfT function complements an auxotrophy

    • Implement FACS-based screening using conformation-sensitive fluorescent probes

    • Establish thermal challenge survival screens to identify stabilized variants

  • High-throughput screening:

    • Employ a GFP fusion reporter system to monitor expression and membrane integration

    • Develop microtiter plate-based transport assays using fluorescent substrate analogs

    • Implement automated colony picking and screening workflows

  • Iterative improvement:

    • Combine beneficial mutations from different rounds of selection

    • Perform deeper characterization of promising variants

    • Implement computational analysis to identify mutation patterns

This approach has been successfully applied to other membrane transporters, yielding variants with 10-15°C increased thermal stability and 2-5 fold enhanced expression levels. For implementation in Bacillus systems, the MICE delivery system provides an efficient means of introducing the mutant libraries into host cells .

What are the current challenges in understanding the interaction between EcfT and other ECF transporter components?

Understanding the dynamic interactions between EcfT and other ECF transporter components presents several research challenges:

  • Conformational flexibility: ECF transporters undergo substantial conformational changes during transport cycles. Current methodological approaches include:

    • Single-molecule FRET to track real-time conformational dynamics

    • Time-resolved cross-linking to capture transport intermediates

    • Molecular dynamics simulations to model transition states

  • Component exchange: ECF transporters display modular architecture where multiple substrate-specific components (EcfS) can interact with a single EcfT-EcfA/A' complex. Research approaches include:

    • Proteomics analysis of co-purified complexes under different growth conditions

    • Affinity purification coupled with quantitative mass spectrometry

    • Bacterial two-hybrid screening to map interaction landscapes

  • Regulatory mechanisms: Understanding how transport activity is regulated in response to cellular needs. Methodological approaches include:

    • Transcriptomic and proteomic profiling under varying nutrient conditions

    • Ribosome profiling to assess translational regulation

    • Metabolomic analysis to correlate transport activity with cellular metabolic state

  • Stoichiometry determination: Establishing the precise subunit composition of functional complexes. Approaches include:

    • Analytical ultracentrifugation with fluorescently labeled components

    • Single-molecule photobleaching analysis

    • Mass photometry for native complex analysis

These investigations require integration of structural, biochemical, and biophysical techniques, ideally using complementary approaches to build a comprehensive understanding of the ECF transport mechanism.

How should researchers interpret contradictory functional data when characterizing recombinant EcfT proteins?

When faced with contradictory functional data for recombinant EcfT proteins, researchers should implement a systematic analytical approach:

Contradictory data often reveals important insights about protein dynamics or regulatory mechanisms, and should be viewed as an opportunity to deepen understanding rather than merely as experimental failure.

What bioinformatic approaches are most valuable for analyzing EcfT sequence-structure-function relationships?

Bioinformatic analysis provides valuable insights into EcfT sequence-structure-function relationships through several methodological approaches:

  • Evolutionary analysis:

    • Multiple sequence alignment of EcfT proteins across bacterial species

    • Phylogenetic tree construction to identify evolutionary relationships

    • Calculation of conservation scores to identify functionally critical residues

    • Analysis of co-evolving residue pairs to predict structural contacts

  • Structural prediction and analysis:

    • Homology modeling based on available ECF transporter structures

    • Molecular dynamics simulations to assess conformational dynamics

    • Electrostatic surface mapping to identify potential interaction sites

    • Transmembrane topology prediction and evaluation

  • Functional domain identification:

    • Motif scanning to identify conserved functional elements

    • Protein domain architecture analysis

    • Identification of substrate-binding sites through conservation patterns

    • Prediction of post-translational modification sites

  • Integration with experimental data:

    • Mapping mutagenesis data onto structural models

    • Correlation of sequence variations with functional differences

    • Analysis of sequence polymorphisms in the context of protein structure

  • Comparative genomics:

    • Analysis of gene neighborhood and operon structure

    • Identification of regulatory elements in promoter regions

    • Correlation of EcfT variants with ecological niches of source organisms

These bioinformatic approaches provide a theoretical framework that guides experimental design and aids in interpreting experimental results, creating a synergistic relationship between computational and laboratory investigations.

How can understanding B. selenitireducens EcfT contribute to broader knowledge of bacterial transport systems?

Research on B. selenitireducens EcfT contributes to our understanding of bacterial transport mechanisms through several avenues:

  • Comparative transport mechanisms: EcfT represents a distinct class of transporters that operate differently from ABC transporters despite sharing ATP-binding components. Detailed structural and functional analysis reveals alternative mechanisms for coupling ATP hydrolysis to substrate translocation across membranes.

  • Adaptation to extreme environments: B. selenitireducens thrives in environments with high selenium concentrations. Studying its EcfT provides insights into how transport systems adapt to extreme conditions, potentially revealing unique structural features or regulatory mechanisms that enable survival.

  • Transport energetics: ECF transporters represent an energy-efficient transport solution compared to conventional ABC transporters. Quantitative analysis of ATP consumption per transport cycle offers insights into bacterial energy economy and resource allocation strategies.

  • Modular protein design: The ECF transporter architecture, with a shared energizing module (EcfT-EcfA-EcfA') interacting with multiple substrate-specific components, represents a fascinating example of modular protein design. This system provides a model for understanding how protein complexes can evolve versatility through component exchange.

These insights extend beyond B. selenitireducens to inform broader principles of membrane transport, protein complex assembly, and bacterial adaptation to diverse environments.

What innovative experimental approaches are emerging for studying membrane protein dynamics in ECF transporters?

Emerging technologies are revolutionizing our ability to study membrane protein dynamics in ECF transporters:

  • Single-molecule techniques:

    • High-speed atomic force microscopy (HS-AFM) for visualizing conformational changes in real-time

    • Single-molecule FRET to track distance changes between labeled domains during transport cycles

    • Fluorescence correlation spectroscopy (FCS) to measure diffusion properties and complex formation

  • Advanced structural methods:

    • Time-resolved cryo-EM to capture transport intermediates

    • Microcrystal electron diffraction (MicroED) for structural determination from vanishingly small crystals

    • Serial femtosecond crystallography using X-ray free-electron lasers for room-temperature structures

  • Cellular imaging approaches:

    • Super-resolution microscopy to visualize transporter distribution and clustering

    • Correlative light and electron microscopy (CLEM) to connect function with ultrastructure

    • Expansion microscopy for enhanced visualization of membrane protein complexes

  • In-cell structural biology:

    • In-cell NMR to observe protein dynamics in the native environment

    • Genetic code expansion to incorporate photo-crosslinkable amino acids at specific positions

    • Proximity labeling methods to map interaction networks in living cells

  • Computational approaches:

    • Enhanced sampling molecular dynamics to model complete transport cycles

    • Machine learning for predicting functional consequences of sequence variations

    • Integrative modeling that combines data from multiple experimental sources

These innovative approaches provide unprecedented views of membrane protein dynamics, enabling researchers to construct more complete models of ECF transporter function that incorporate both structural and dynamic aspects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.