Recombinant Bacillus subtilis ABC transporter permease ytrF (ytrF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us, and we will prioritize its implementation.
Synonyms
ytrF; BSU30410; ABC transporter permease YtrF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
32-436
Protein Length
Full Length of Mature Protein
Species
Bacillus subtilis (strain 168)
Target Names
ytrF
Target Protein Sequence
CAFLVVLSSVGFGIQKTITDMTMSQQIVTKVSVMGKEGDKPIKKADLEKYDHVRSVVERT QVYEPNKATLGNRTNESSNLIFTNMNDELKANMELEKGRVAKSENEIVVGYDFAKRLLTK KESEEYNKKIEEAKGNPEDIKEPKGYTKDILNKTIELSVSKTDSKTGDVTKTKTYDFKIV GITKKPSQDWMEDSNIFISDQFKKDFSEFLDFKGGNVETNIGVFADKFENVEQLTNDLTD DGYYVTSVTTELEGANTFFMVFKIGLIFVGCIAVIISAIGIFNTMTMAVTERTQEIGIMK AIGASPSIIRRMFLMESAYIGILGCVIGIIISYGVSYLVNLAVPMILAATSGGDAGDLNY TFSYIPASLVIIAVVICGGVAVISGMNPARKATKTNVLTALRREL
Uniprot No.

Target Background

Function
Recombinant Bacillus subtilis ABC transporter permease ytrF (ytrF) is a component of the YtrBCDEF transporter complex. It plays a crucial role in acetoin utilization during stationary phase and sporulation.
Database Links
Protein Families
ABC-4 integral membrane protein family
Subcellular Location
Cell membrane; Lipid-anchor. Cell membrane; Multi-pass membrane protein.

Q&A

What is YtrF and what role does it play in Bacillus subtilis?

YtrF functions as the substrate binding protein of the YtrBCDEF ABC transporter in Bacillus subtilis. Within this transporter system, YtrF interacts with the transmembrane proteins YtrC and YtrD, while YtrB and YtrE serve as nucleotide binding proteins. This transport system is involved in multiple cellular processes including genetic competence development, biofilm formation, and cell wall homeostasis regulation. The expression of the ytrF gene, along with the entire ytrGABCDEF operon, is naturally induced under specific conditions such as exposure to cell wall-targeting antibiotics and cold shock .

How is the ytrF gene organized within the genome of B. subtilis?

The ytrF gene is positioned as the terminal gene in the ytrGABCDEF operon. This operon is regulated by the transcriptional repressor YtrA, which is also encoded within the same operon. YtrA belongs to the GntR family of transcription regulators and binds to a specific inverted repeat sequence (AGTGTA-13bp-TACACT) in the promoter region of its own operon and another operon, ywoBCD. The genomic organization follows the sequence ytrG, ytrA, ytrB, ytrC, ytrD, ytrE, and finally ytrF, with each gene contributing to the functionality of this complex ABC transporter system .

What is the structural organization of the YtrBCDEF transporter complex?

The YtrBCDEF transporter follows the typical organization of ABC transporters, consisting of multiple functional components: two nucleotide binding proteins (YtrB and YtrE), two membrane-spanning proteins (YtrC and YtrD), and YtrF as the substrate binding protein that interacts with the transmembrane components. This architecture allows for the coordinated transport of substrates across the cell membrane. While YtrF's exact three-dimensional structure isn't detailed in current research, its function as a substrate binding protein suggests it contains domains for specific substrate recognition and binding, as well as regions that facilitate interaction with the transmembrane components of the transporter .

How is ytrF expression regulated in wild-type B. subtilis?

In wild-type Bacillus subtilis, ytrF expression is tightly controlled by the transcription factor YtrA, which acts as a negative regulator of the entire ytrGABCDEF operon. YtrA binds to an inverted repeat sequence in the promoter region to repress transcription under normal conditions. The operon becomes induced under specific stress conditions, particularly in response to cell wall-targeting antibiotics and cold shock. Experimental data has demonstrated that when YtrA is deleted, there is dramatic overexpression of the downstream genes including ytrF. Quantitative RT-PCR analysis revealed that in a ytrA mutant strain, ytrF expression increased by 566-fold compared to the wild-type strain, highlighting the powerful repressive function of YtrA under normal conditions .

What experimental approaches can be used to study YtrF overexpression?

Several sophisticated experimental approaches have been successfully employed to study YtrF overexpression:

  • Repressor deletion: Removing the ytrA repressor gene leads to constitutive overexpression of the entire ytrBCDEF operon. When ytrA is replaced with an erythromycin resistance cassette, the downstream genes come under the control of the ermC promoter, resulting in significant overexpression .

  • Inducible expression systems: Placing ytrF under the control of a xylose-inducible promoter (as in strain GP3197) allows for precise, titratable expression by simply adding xylose to the growth medium .

  • Selective gene deletion strategies: By deleting specific components of the operon while maintaining ytrF expression (as in strain GP3186, where all other components ytrGABCDE were deleted), researchers can study the effects of YtrF overexpression in isolation from other transporter components .

  • Quantification methods: qRT-PCR analysis provides reliable quantification of ytrF expression levels in various genetic constructs relative to wild-type strains, allowing researchers to correlate expression levels with observed phenotypes .

How do environmental conditions affect ytrF expression?

The expression of ytrF responds to several environmental and experimental conditions:

  • Cell wall stress: The ytrGABCDEF operon is naturally induced by antibiotics that target the bacterial cell wall, suggesting a role in cell wall stress response mechanisms .

  • Temperature shifts: Cold shock conditions have been shown to induce the operon, providing an additional environmental parameter for modulating expression .

  • Growth phase dependence: Since competence development in B. subtilis (which is affected by YtrF) occurs during stationary phase and high cell density, these conditions may indirectly influence ytrF expression patterns .

  • Artificial induction systems: Using engineered promoter systems, such as xylose-inducible promoters, researchers can precisely control ytrF expression independent of its natural regulatory mechanisms .

How does YtrF affect the genetic competence of B. subtilis?

Research has demonstrated that overexpression of the YtrBCDEF transporter, including YtrF, significantly impairs the genetic competence of B. subtilis. When the ytrA repressor is deleted, leading to overexpression of all transporter components, there is a substantial loss of transformability. Interestingly, detailed genetic studies revealed that overexpression of YtrF alone is not sufficient to block competence, suggesting that YtrF requires other components of the transporter or additional cellular factors to exert its effect on competence. Further experimental evidence showed that strains overexpressing YtrC, YtrD, and YtrF (even in the absence of YtrB and YtrE) produced very few transformants, indicating that these three components might be the minimal set required to inhibit genetic competence .

What mechanisms connect YtrF overexpression to reduced DNA uptake?

Several potential mechanisms have been identified that could explain how YtrF overexpression inhibits DNA uptake:

  • Cell wall modification: Overexpression of the YtrBCDEF transporter, including YtrF, significantly increases cell wall thickness in B. subtilis, from approximately 21 nm in wild-type cells to 31 nm in ytrA mutants. Since the composition and properties of the cell wall are critical for competence development, this increased thickness likely creates a physical barrier impeding DNA uptake .

  • Interaction with competence machinery: YtrF and other components of the ABC transporter may directly or indirectly interfere with proteins involved in DNA binding, uptake, or processing during the competence process.

  • Requirement for coordinated expression: The observation that YtrF alone is insufficient to block competence suggests a complex mechanism requiring multiple components working in concert to affect DNA uptake mechanisms .

  • Possible effects on ComK activity: Some evidence suggests that YtrA (the repressor of ytrF) may be required for both ComK activity and downstream processes of DNA uptake and integration. This raises the possibility that overexpression of YtrF due to ytrA deletion might indirectly impact competence through altered ComK regulation or activity .

What methods are effective for measuring YtrF's impact on transformation efficiency?

Researchers have employed several quantitative approaches to measure how YtrF affects transformation efficiency:

  • Transformation frequency assays: Counting the number of transformants obtained after introducing foreign DNA into various strains (wild-type, ytrA deletion, various combination deletions of ytr genes) provides a direct measurement of competence .

  • Genetic dissection: Creating strains with specific deletions or combinations of deletions (e.g., ytrA and ytrF double mutants) helps assess the contribution of individual components to the competence phenotype .

  • Expression correlation: Quantitative RT-PCR analysis confirms the overexpression of specific genes in different genetic backgrounds, allowing researchers to correlate expression levels with observed transformation efficiencies .

  • Complementation analysis: Testing whether providing functional copies of deleted genes can restore competence helps confirm the specific gene functions and rule out polar effects of mutations .

How does YtrF overexpression influence biofilm development?

Research demonstrates that overexpression of the YtrBCDEF transporter impacts biofilm formation in B. subtilis in addition to affecting genetic competence. When the ytrA repressor is deleted (leading to overexpression of YtrF and other transporter components), biofilm structure is noticeably altered. Specifically, a ytrA mutant strain (GP3212) forms biofilms that are less structured and more translucent, with only minor surface wrinkles, compared to the well-structured colonies of wild-type strains. This indicates that biofilm formation is inhibited, though not completely eliminated, when YtrF and other transporter components are overexpressed. Importantly, a strain lacking the entire ytrGABCDEF operon forms biofilms that are indistinguishable from wild-type, suggesting that it's specifically the overexpression of the transporter components, rather than their absence, that interferes with normal biofilm development .

What experimental methods can quantify YtrF's effects on biofilm structure?

Based on published research, several approaches have been used to assess and quantify biofilm structure in relation to YtrF:

For comprehensive quantification, researchers might also consider supplementary methods such as crystal violet staining for biomass quantification, confocal microscopy for three-dimensional structure analysis, or expression analysis of biofilm matrix component genes.

What is the relationship between YtrF-mediated cell wall changes and biofilm formation?

The research indicates a mechanistic connection between YtrF-mediated cell wall modifications and altered biofilm formation. Overexpression of the YtrBCDEF transporter leads to significantly increased cell wall thickness (from 21 nm in wild-type to 31 nm in ytrA mutants). Since biofilm formation relies on complex cell-cell interactions, matrix production, and environmental sensing, these structural changes to the cell envelope likely disrupt normal biofilm development processes. The thickened cell wall may alter cell surface properties, affecting cell-cell adhesion, hydrophobicity, or the secretion and assembly of extracellular matrix components. This provides a potential mechanistic explanation for why YtrF overexpression results in biofilms that are less structured and more translucent than those formed by wild-type B. subtilis .

How does YtrF overexpression modify B. subtilis cell wall properties?

Overexpression of the YtrBCDEF transporter, including YtrF, induces significant and measurable changes to B. subtilis cell wall properties:

  • Increased cell wall thickness: Transmission electron microscopy (TEM) analysis revealed that wild-type B. subtilis has an average cell wall thickness of approximately 21 nm, whereas the ytrA mutant (which overexpresses the transporter) exhibits a substantially increased thickness of 31 nm. Similar increases were observed in strains lacking one of the nucleotide binding proteins (YtrB or YtrE) in addition to YtrA .

  • Specificity to overexpression: Importantly, a strain lacking the entire ytrGABCDEF operon maintained normal cell wall thickness (23 nm), similar to wild-type. This indicates that it's specifically the overexpression of transporter components, rather than their absence, that leads to increased cell wall thickness .

  • Functional consequences: These changes in cell wall architecture appear to have direct functional consequences, as they correlate with both decreased genetic competence and altered biofilm formation, suggesting that cell wall structure is a critical determinant of these processes .

What techniques provide the most accurate measurements of cell wall thickness?

Transmission Electron Microscopy (TEM) has been established as the gold standard technique for measuring cell wall thickness in B. subtilis strains with different YtrF expression levels. This technique allows for:

  • Direct visualization of cell wall ultrastructure with nanometer resolution

  • Precise measurement of cell wall thickness at multiple points along the cell periphery

  • Statistical analysis of measurements from multiple cells to establish significant differences between strains

  • Correlation of structural observations with functional phenotypes

In the published research, TEM analysis clearly demonstrated the increase in cell wall thickness from 21 nm in wild-type to 31 nm in strains overexpressing the YtrBCDEF transporter, providing critical evidence for the mechanism by which YtrF affects cellular processes .

What is the relationship between YtrF, cell wall composition, and antibiotic responses?

Several lines of evidence suggest important relationships between YtrF, cell wall composition, and antibiotic responses:

  • Antibiotic induction: The ytrGABCDEF operon is naturally induced by cell wall-targeting antibiotics, suggesting that the YtrBCDEF transporter system forms part of B. subtilis' adaptive response to cell wall stress or damage .

  • Cell wall thickness: Overexpression of the YtrBCDEF transporter leads to significantly increased cell wall thickness, which could potentially affect the penetration and efficacy of various antibiotics .

  • Regulatory connections: The YtrA repressor controls the expression of both its own operon (ytrGABCDEF) and another operon (ywoBCD), suggesting coordinated regulation of multiple systems involved in cell envelope homeostasis .

  • Potential transport function: As an ABC transporter, the YtrBCDEF system likely transports specific substrates that may be directly involved in cell wall synthesis, modification, or repair, which could influence antibiotic susceptibility profiles.

These connections suggest that the YtrBCDEF transporter, with YtrF as a key component, may play important roles in antibiotic resistance or tolerance mechanisms through its effects on cell wall structure and composition.

What genetic manipulation strategies are optimal for studying YtrF function?

Several sophisticated genetic manipulation strategies have proven effective for dissecting YtrF function:

  • Precise gene deletion approaches:

    • Targeted deletion of ytrA repressor to study effects of YtrF overexpression

    • Complete deletion of the ytrGABCDEF operon to establish baseline phenotypes

    • Selective deletion of specific genes within the operon (e.g., ytrB, ytrC, ytrD, ytrE, ytrF) to dissect individual component contributions

    • Construction of double mutants (e.g., ytrA with each other gene) to study genetic interactions and component dependencies

  • Expression control systems:

    • Implementation of inducible promoter systems (e.g., xylose-inducible promoter for ytrF) to achieve titratable expression

    • Utilization of antibiotic resistance cassette promoters (e.g., ermC promoter) to drive expression of downstream genes

  • Marker-based techniques:

    • Strategic use of antibiotic resistance markers (e.g., kanamycin, erythromycin) for selection

    • Implementation of markerless deletion strategies using Lox sites and Cre recombinase (via plasmid pDR244) for clean genetic modifications

  • PCR-based construction methods:

    • Amplification of gene regions with primers containing specific overhangs for fusion PCR

    • Confirmation of genetic modifications by PCR with primers flanking the deletion sites

These approaches enable researchers to create precise genetic constructs for systematically analyzing YtrF function in various contexts and genetic backgrounds.

How can experimental design help distinguish between direct and indirect effects of YtrF?

Distinguishing between direct and indirect effects of YtrF requires carefully designed experimental approaches:

  • Genetic dissection: Creating strains with specific combinations of deletions (as described in the research) helps determine which components are essential for observed phenotypes. For example, studies showed that overexpression of YtrF alone was insufficient to block competence, while overexpression of YtrC, YtrD, and YtrF together was sufficient, indicating complex interactions rather than a direct effect of YtrF alone .

  • Correlation analysis: Measuring cell wall thickness in various genetic backgrounds and correlating these measurements with functional phenotypes (competence, biofilm formation) helps establish causal relationships. The research demonstrated that increased cell wall thickness correlates with loss of competence and altered biofilm formation .

  • Complementation studies: Reintroducing wild-type copies of deleted genes can confirm whether phenotypes are directly caused by the absence of specific proteins or are due to downstream effects.

  • Controlled expression systems: Using inducible promoters (like the xylose-inducible system for ytrF expression) allows for titration of expression levels and determination of threshold effects .

  • Time-resolved analysis: Monitoring changes in phenotypes over time after induction of YtrF expression could help distinguish immediate (likely direct) effects from delayed (likely indirect) effects.

What biochemical approaches can characterize YtrF substrate specificity?

While current research hasn't fully characterized YtrF substrate specificity, several biochemical approaches would be valuable for this purpose:

  • Protein purification: Developing protocols for purifying active YtrF protein while maintaining its native conformation and substrate-binding capability.

  • Binding assays: Implementing direct binding assays using techniques such as:

    • Isothermal titration calorimetry (ITC) for thermodynamic characterization of binding

    • Surface plasmon resonance (SPR) for measuring binding kinetics

    • Fluorescence-based assays for high-throughput screening of potential substrates

  • Structural studies: Determining the three-dimensional structure of YtrF alone and in complex with potential substrates using X-ray crystallography or cryo-electron microscopy.

  • Transport assays: Developing reconstituted systems or whole-cell assays to measure the transport of potential substrates by the complete YtrBCDEF transporter.

  • Mutagenesis studies: Creating targeted mutations in predicted substrate-binding regions of YtrF and assessing their impact on binding and transport activities.

  • Competition assays: Testing whether different compounds can compete for binding to YtrF to establish relative affinities and specificity profiles.

These approaches would provide complementary information about YtrF substrate specificity, advancing our understanding of this important component of the YtrBCDEF ABC transporter system.

How does YtrF interact with other components of the YtrBCDEF transporter?

Research has elucidated several aspects of YtrF's interactions within the YtrBCDEF transporter complex:

  • Functional organization: Within the transporter system, YtrF serves as the substrate binding protein, while YtrB and YtrE function as nucleotide binding proteins, and YtrC and YtrD act as membrane spanning proteins that form the transmembrane channel .

  • Direct membrane protein interactions: YtrF is specifically described as "the only substrate binding protein that interacts with the transmembrane proteins," indicating direct physical interactions with YtrC and YtrD that are critical for transporter function .

  • Functional interdependence: Experimental evidence suggests that YtrF requires other components of the transporter for its full activity and proper localization. This is supported by the observation that overexpression of YtrF alone did not block competence, while overexpression of YtrF in combination with other components did affect this phenotype .

  • Unexpected functional relationships: Intriguingly, research revealed that the loss of competence associated with YtrF overexpression did not depend strictly on the nucleotide binding proteins (YtrB and YtrE) or even the transmembrane proteins (YtrC and YtrD). This led researchers to hypothesize that "YtrF might require assistance of another, unknown factor" beyond the canonical components of the transporter system .

These complex interactions form the structural and functional basis for the YtrBCDEF transporter's activities in B. subtilis.

What evidence suggests YtrF functions beyond the canonical ABC transporter role?

Several experimental observations suggest YtrF may have functions that extend beyond its canonical role in the ABC transporter:

  • Independent effects: The finding that YtrF overexpression affects cell processes even in the absence of some canonical transporter components suggests potential moonlighting functions or interactions with other cellular systems .

  • Broad physiological impacts: The effects of YtrF overexpression on multiple cellular processes (competence, biofilm formation, cell wall structure) point to roles in coordinating different aspects of B. subtilis physiology .

  • Unclear dependency relationships: The observation that "YtrF might require assistance of another, unknown factor" indicates potential interactions with proteins or systems outside the YtrBCDEF transporter complex .

  • Connection to stress responses: The natural induction of the ytrGABCDEF operon by cell wall-targeting antibiotics and cold shock suggests YtrF may participate in broader stress response networks beyond simple transport functions .

These observations collectively suggest that YtrF's cellular functions may be more complex and integrated than would be expected for a component acting solely within an ABC transporter system.

How might YtrF contribute to cell wall homeostasis mechanisms?

Research findings point to several mechanisms by which YtrF may contribute to cell wall homeostasis:

  • Transport of cell wall precursors or modifiers: As part of an ABC transporter, YtrF may bind specific substrates involved in cell wall synthesis, modification, or repair. This is supported by the significant increase in cell wall thickness observed when the transporter is overexpressed .

  • Stress response integration: The natural induction of the ytrGABCDEF operon by cell wall-targeting antibiotics suggests the transporter system plays a role in responding to and mitigating cell wall damage .

  • Regulatory feedback: YtrF activity may provide feedback to cellular systems that control cell wall synthesis rates or composition, explaining the dramatic thickness changes observed in overexpression strains.

  • Coordination with other cell envelope processes: The impact of YtrF overexpression on both competence and biofilm formation suggests it may help coordinate cell wall properties with these developmental programs, potentially through effects on the physical and chemical properties of the cell envelope .

  • Potential export of cell wall modifying enzymes: The transporter might be involved in the export of enzymes or other factors that directly modify the cell wall structure, explaining the increased thickness phenotype.

These potential mechanisms highlight YtrF's importance in maintaining proper cell wall structure and function, with significant implications for B. subtilis physiology and development.

What are the most promising approaches for identifying YtrF substrates?

Several cutting-edge approaches hold promise for identifying the elusive substrates of YtrF:

  • Metabolomics profiling: Comparing the metabolome of wild-type B. subtilis with strains lacking or overexpressing YtrF could reveal accumulated or depleted compounds that might represent transporter substrates.

  • Chemical proteomics: Using modified potential substrates with photoaffinity labels could help capture direct binding interactions with YtrF.

  • Structural biology: Determining the three-dimensional structure of YtrF, particularly its substrate-binding domain, could provide insights into the types of molecules it might bind.

  • Computational docking: Virtual screening of potential substrates against a YtrF structural model could prioritize candidates for experimental validation.

  • Phenotypic screening: Systematic testing of growth and stress response phenotypes in the presence of various compounds could identify conditions where YtrF activity becomes essential.

  • Comparative genomics: Analyzing the conservation and genomic context of ytrF across bacterial species might reveal associated metabolic pathways and potential substrates.

  • Substrate trapping mutants: Developing YtrF variants that bind but cannot release substrates could help capture and identify physiological binding partners.

How might understanding YtrF function contribute to antimicrobial development?

Understanding YtrF function could contribute to antimicrobial development through several avenues:

  • Novel target identification: As part of a system involved in cell wall homeostasis and antibiotic responses, the YtrBCDEF transporter represents a potential target for new antimicrobial compounds.

  • Resistance mechanism insights: The induction of the ytrGABCDEF operon by cell wall antibiotics suggests this system may contribute to antibiotic tolerance or resistance mechanisms . Understanding these processes could help develop strategies to overcome resistance.

  • Competence inhibition: The role of YtrF in inhibiting genetic competence when overexpressed suggests potential approaches for limiting horizontal gene transfer, which contributes to the spread of resistance genes.

  • Biofilm disruption: Given YtrF's impact on biofilm formation, insights into its function could lead to strategies for disrupting biofilms, which are notoriously resistant to conventional antibiotics.

  • Cell wall targeting: The increased cell wall thickness resulting from YtrF overexpression suggests that targeting this system might sensitize bacteria to existing cell wall-active antibiotics by preventing compensatory thickening.

  • Adjuvant development: Compounds that modulate YtrF function might serve as adjuvants that enhance the efficacy of existing antibiotics by interfering with cellular stress responses.

What technological advances would accelerate research on YtrF and related transporters?

Several technological advances would significantly accelerate research on YtrF and related transporters:

  • Improved membrane protein structural biology techniques: Advances in cryo-electron microscopy and other structural approaches that can better resolve membrane protein complexes would facilitate understanding of the complete YtrBCDEF transporter architecture.

  • High-throughput substrate screening platforms: Development of systems that can rapidly test thousands of potential substrates for binding to or transport by YtrF would accelerate substrate identification.

  • Advanced imaging technologies: Super-resolution microscopy techniques that could visualize YtrF localization and dynamics in living cells would provide insights into its behavior under different conditions.

  • Sensitive transport assays: Development of more sensitive and specific assays to measure substrate transport in real-time would help characterize transporter kinetics and specificity.

  • Single-cell analysis methods: Technologies that can measure cell wall properties, competence, and other YtrF-affected parameters at the single-cell level would reveal population heterogeneity and regulatory mechanisms.

  • Computational prediction algorithms: Improved bioinformatic tools for predicting substrate-protein interactions based on sequence and structural information would accelerate hypothesis generation.

  • Synthetic biology approaches: Advanced genetic tools for precise control of gene expression and protein engineering in B. subtilis would facilitate more sophisticated functional studies of YtrF and the entire transporter system.

These technological advances would enable researchers to more quickly unravel the complex functions of YtrF and related bacterial transporters, potentially leading to new insights with both fundamental and applied significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.