Recombinant Bacillus subtilis Antiholin-like protein LrgB (lrgB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks if needed. We will fulfill requests whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline for your preparations.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
lrgB; ysbB; BSU28900; Antiholin-like protein LrgB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
lrgB
Target Protein Sequence
MESTMSPYFGIVVSLAAFGIGTFLFKKTKGFFLFTPLFVAMVLGIAFLKIGGFSYADYNN GGEIIKFFLEPATIAFAIPLYKQRDKLKKYWWQIMASIIAGSICSVTIVYLLAKGIHLDS AVMKSMLPQAATTAIALPLSKGIGGISDITAFAVIFNAVIVYALGALFLKVFKVKNPISK GLALGTSGHALGVAVGIEMGEVEAAMASIAVVVVGVVTVLVIPVFVQLIGG
Uniprot No.

Target Background

Function
Recombinant Bacillus subtilis Antiholin-like protein LrgB (lrgB) inhibits the expression or activity of extracellular murein hydrolases. This is achieved through interaction, potentially with LrgA and the holin-like protein CidA. LrgAB and CidA proteins may influence the membrane's proton motive force. LrgB may also play a role in programmed cell death (PCD), potentially triggering PCD in response to antibiotics and environmental stresses.
Database Links
Protein Families
CidB/LrgB family, LrgB subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the primary function of LrgB protein in Bacillus subtilis compared to other bacterial species?

    LrgB in Bacillus subtilis functions primarily as part of a hetero-oligomeric membrane complex that acts as a facilitated pyruvate transporter. The ysbAB operon (which has been renamed pftAB - pyruvate facilitated transporter) encodes this complex . This represents a significant functional divergence from its homologues in other species.

    In contrast, in Staphylococcus aureus, LrgB is more directly associated with controlling cell lysis and biofilm formation. The LrgB protein in S. aureus is analogous to phage anti-holin proteins that prevent membrane depolarization . This functional diversity demonstrates how these structurally similar proteins have evolved different roles across bacterial species despite sharing common ancestry.

    The table below summarizes the functional differences:

    SpeciesPrimary LrgB FunctionAssociated Processes
    B. subtilisPyruvate transportMetabolism, cell energetics
    S. aureusPrevention of membrane depolarizationCell lysis control, biofilm regulation
  • How does the inactivation of lrgB gene affect biofilm formation in bacterial systems?

    Inactivation of lrgB significantly increases biofilm formation. Studies have demonstrated that lrgB knockout mutants in S. aureus (both Tn551::lrgB and ΩlrgB::pLGEM mutants) formed substantially more biofilm compared to wild-type strains .

    This phenotype is attributed to increased autolysis in lrgB mutants, which leads to enhanced release of extracellular DNA (eDNA) - a key structural component of biofilms. Conversely, superexpression of lrgB inhibits biofilm accumulation .

    Quantitatively, studies have shown extremely significant increases in bacterial cell lysis (p<0.0001) when either lrgB or yycI are disrupted, contributing to the enhanced biofilm phenotype .

  • What is the relationship between LrgB and bacterial competence for DNA uptake?

    While LrgB itself is not directly characterized as a competence protein, both competence and LrgB function within the complex adaptive network of Bacillus subtilis. B. subtilis is capable of natural competence, allowing cells to take up exogenous DNA from the environment .

    Cytological and genetic evidence suggests that the B. subtilis DNA uptake machinery localizes at a single cell pole and requires various recombination proteins including RecA for chromosomal transformation, and RecO and RecU for plasmid establishment . The relationship between competence and membrane functions (where LrgB operates) represents an interesting intersection worth further investigation, especially since both involve cell envelope-related processes.

  • What is the genetic organization of the lrgB locus in Bacillus subtilis?

    In Bacillus subtilis, lrgB is part of the ysbAB operon, which has been renamed pftAB (pyruvate facilitated transporter) . Although specific details of the B. subtilis lrgB locus organization aren't explicitly described in the provided search results, we can infer from studies in S. aureus that lrgB is likely co-expressed with lrgA.

    In S. aureus, the lrgAB operon is positively regulated by the lytSR operon . It's worth noting that "despite cidB and lrgB being co-expressed with cidA and lrgA, respectively, their real functions in S. aureus are not completely understood" . This suggests a complex transcriptional organization that may be conserved to some degree in B. subtilis.

Advanced Research Questions

  • What experimental methods are most effective for studying lrgB function in biofilm formation?

    Based on published research, several methodological approaches have proven effective for studying lrgB function:

    a) Genetic knockout studies: Creating lrgB mutants through allelic recombination or transposon insertion (e.g., Tn551) .

    b) In vivo biofilm models: Using catheter implantation in mice to assess biofilm development. This methodology involves:

    • Inoculating polyurethane catheter segments with mid-exponential growth phase cultures

    • Surgical implantation in the back of mice (anesthetized with ketamine and thiopental)

    • Euthanizing animals after three days post-infection

    • Surgically removing catheter segments to assess biofilm by counting catheter-adherent bacteria

    c) Autolysis assays: Measuring OD600nm every 15 minutes for up to 4 hours to quantify cell lysis rates .

    d) eDNA quantification: Measuring extracellular DNA content in biofilm supernatants to correlate with biofilm formation capacity .

    e) Superexpression studies: Using cadmium-inducible promoters to examine the effects of lrgB overexpression .

  • How can researchers effectively express and purify recombinant LrgB protein for functional studies?

    Bacillus subtilis itself serves as an excellent expression system for recombinant proteins, including membrane proteins like LrgB. Several approaches can be considered:

    a) Expression system selection: B. subtilis provides advantages for expressing its native proteins due to its GRAS (generally recognized as safe) status and innate ability to absorb and incorporate exogenous DNA .

    b) Promoter selection: Several options exist for controlled expression:

    • IPTG-inducible promoters (e.g., Pgrac212) have been used successfully for membrane proteins

    • Self-inducible expression systems without inducers using strong promoters like Pgrac100

    c) Purification strategies: For membrane proteins like LrgB, consider:

    • Detergent solubilization methods

    • Affinity tags (His-tags have been used successfully with B. subtilis proteins)

    • Size exclusion chromatography for final purification

    d) Functional validation: Pyruvate transport assays would be appropriate for confirming the functionality of purified LrgB .

  • What is the mechanistic relationship between cell lysis, eDNA release, and LrgB function?

    Research has established a clear mechanistic pathway connecting LrgB function to biofilm formation through the regulation of cell lysis and eDNA release:

    a) Anti-autolytic function: LrgB functions as part of the bacterial holin/anti-holin system, analogous to phage anti-holin proteins that prevent membrane depolarization .

    b) Lysis regulation: When lrgB is inactivated, bacterial autolysis increases significantly (p<0.0001 in studies), likely due to the loss of this anti-holin function .

    c) eDNA release pathway: Increased autolysis leads to higher amounts of extracellular DNA release. Studies have quantitatively demonstrated higher eDNA content in biofilm supernatants of lrgB mutants (p<0.01) .

    d) Biofilm matrix enhancement: The released eDNA serves as a structural component that enhances biofilm matrix integrity and stability .

    This pathway explains the seemingly paradoxical observation that disrupting a single gene (lrgB) can actually enhance a complex phenotype like biofilm formation.

  • How does LrgB interact with the YycGF (WalKR) two-component regulatory system?

    The interaction between LrgB and the YycGF (WalKR) two-component system involves several components:

    a) Regulatory connection: The YycI protein (which affects biofilm formation similarly to LrgB when inactivated) participates in the activation/repression of the YycGF (WalKR) two-component system .

    b) Parallel pathways: Both lrgB and yycI genes belong to distinct operons that repress bacterial autolysis through different mechanisms :

    • LrgB is associated with phage holin/anti-holin analogues

    • YycI participates in the regulation of YycGF (WalKR)

    c) Functional convergence: Despite being in separate pathways, both lrgB and yycI knockouts show similar phenotypes regarding biofilm formation and autolysis, suggesting a convergence of these regulatory systems on common downstream targets .

    d) Cell wall connection: Previous studies suggest that YycG/YycF (WalK/WalR) TCS promotes the activation of genes involved in cell wall degradation, providing another connection to autolysis processes .

  • What are the current experimental design limitations in studying LrgB function?

    Several experimental challenges exist when studying LrgB:

    a) Membrane protein challenges: As a membrane protein, LrgB presents typical difficulties including:

    • Maintaining native conformation during extraction and purification

    • Ensuring proper folding in recombinant expression systems

    • Developing appropriate functional assays for a membrane-bound transporter

    b) Redundancy in function: The existence of multiple pathways affecting autolysis and pyruvate metabolism can complicate the interpretation of single-gene knockout studies .

    c) Assay limitations: Current methods for measuring pyruvate transport often lack the temporal resolution needed to capture rapid transport kinetics.

    d) In vivo relevance: Bridging the gap between in vitro findings and in vivo significance remains challenging, requiring sophisticated animal models as demonstrated in catheter implantation studies .

    e) Technical considerations: When designing experiments, researchers should consider:

    • Proper controls for genetic manipulations

    • Clearly defined experimental variables

    • Randomization and balancing of experimental conditions

  • How can Design of Experiments (DOE) methodology be applied to optimize recombinant LrgB expression?

    Design of Experiments (DOE) offers a systematic approach to optimize recombinant LrgB expression with several key applications:

    a) Sequential experimental approach: Rather than attempting to optimize all parameters simultaneously, use DOE sequentially, with each iteration bringing you closer to optimal conditions .

    b) Variable definition and screening:

    • Clearly define independent variables (e.g., temperature, inducer concentration, media composition)

    • Identify dependent variables (protein yield, activity, solubility)

    • Control for confounding variables (batch effects, cell density)

    c) DOE design selection: For LrgB expression optimization, consider these designs:

    • Screening designs (fractional factorial) to identify significant factors affecting expression

    • Response surface methodology to optimize the identified critical factors

    • Full factorial designs for final optimization of a smaller set of crucial variables

    d) Factor considerations specific to LrgB expression:

    • Induction timing and concentration (if using inducible promoters)

    • Expression temperature (lower temperatures may help membrane protein folding)

    • Media composition (especially carbon source considering LrgB's role in pyruvate transport)

    • Cell lysis conditions (critical for membrane protein extraction)

    This structured approach can significantly reduce the experimental burden while achieving robust optimization of recombinant LrgB expression conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.