Recombinant Bacillus subtilis ATP synthase protein I (atpI)

Shipped with Ice Packs
In Stock

Description

Introduction

Bacillus subtilis is a Gram-positive bacterium well-regarded for its ability to produce recombinant proteins, making it a valuable host for biotechnological and industrial applications . B. subtilis has a GRAS ("generally recognized as safe") status and a remarkable innate ability to absorb and incorporate exogenous DNA into its genome, making this organism an ideal platform for the heterologous expression of bioactive substances . Among the many proteins that can be produced using Bacillus subtilis is ATP synthase, specifically subunit I (atpI). ATP synthase is an essential enzyme complex responsible for ATP production in all living organisms .

ATP Synthase in Bacillus subtilis

ATP synthase, also known as F0F1-ATPase, is a complex enzyme that synthesizes ATP from ADP and inorganic phosphate (Pi) using a proton gradient across a membrane . In Bacillus subtilis, ATP synthase is encoded by the atp operon, which contains nine genes coding for the subunits of the F0F1 ATP synthase . The arrangement of these genes in the operon is identical to that of the atp operon from Escherichia coli and from three other Bacillus species . The deduced amino acid sequences of the nine subunits are very similar to their counterparts from other organisms .

The atp Operon and its Subunits

The atp operon in Bacillus subtilis consists of nine genes that encode different subunits of the ATP synthase complex . These subunits are essential for the assembly and function of the enzyme. The atpI gene encodes for the subunit I of the ATP synthase complex.

Recombinant Production of atpI

Recombinant production of atpI in Bacillus subtilis involves introducing a genetically modified version of the atpI gene into Bacillus subtilis cells . This modified gene is often placed under the control of a strong promoter to enhance protein expression . Various expression systems have been developed to optimize recombinant protein production in B. subtilis, including those using chemical inducers like IPTG or self-inducing systems .

Significance of atpI

The ability to produce atpI recombinantly allows for detailed studies of its structure and function, as well as its potential applications. For example, researchers can study the effects of mutations in the atpI gene on ATP synthase activity and bacterial growth .

Applications and Future Directions

Recombinant Bacillus subtilis strains producing atpI can be used for various applications:

  • Structural and Functional Studies: Recombinant atpI allows for detailed structural and functional analyses of the ATP synthase complex.

  • Drug Discovery: ATP synthase is a target for antibacterial compounds, and recombinant atpI can be used to screen for new inhibitors .

  • Metabolic Engineering: Modifying ATP synthase activity can impact cellular energy levels and metabolic fluxes .

  • Biotechnological Applications: Enhanced ATP production can improve the efficiency of various bioprocesses.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpI; BSU36880; ATP synthase protein I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
atpI
Target Protein Sequence
MDDPKLTFSRQRKYLLFILAVYVLGYGLTAYKTVFLGLILGTVFSLFNFLLLVRRMNAFD RAVEKGKSIRSLGSAARWCNAILAVAVAYKNPEYFHMASTVIGLMTIYPVIMIDSFIQLK RSSMEER
Uniprot No.

Target Background

Function

This protein potentially functions in guiding the assembly of the membrane sector of the ATP synthase enzyme complex.

Database Links
Protein Families
Bacterial AtpI family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase protein I (atpI) in Bacillus subtilis and what is its primary function?

ATP synthase protein I (atpI) is a membrane protein encoded by the atp operon in Bacillus subtilis. Its primary function appears to be facilitating the assembly of the ATP synthase complex, particularly in the formation of the c-ring oligomer. Based on studies in related bacteria, atpI serves as a chaperone-like protein during ATP synthase assembly, though its absolute requirement varies between bacterial species . Unlike structural components of ATP synthase, atpI is not part of the final functional complex but rather assists in its proper assembly.

The protein is characterized as a facultative anaerobe, capable of functioning in both aerobic and anaerobic conditions, mirroring the adaptability of B. subtilis itself . This characteristic makes atpI particularly interesting for studying protein function under various environmental conditions.

How does the structure of atpI relate to its function in ATP synthase assembly?

AtpI is a hydrophobic membrane protein with multiple predicted transmembrane domains that adopt primarily alpha-helical structures. While high-resolution structural data specifically for B. subtilis atpI is limited, functional studies in related organisms provide insights into structure-function relationships:

  • The transmembrane domains likely facilitate interaction with the c-subunits during ring assembly

  • The protein contains regions that enable specific recognition of c-subunits to ensure proper oligomerization

  • The membrane-embedded nature allows atpI to facilitate proper insertion of c-subunits into the membrane

Studies in B. pseudofirmus OF4 demonstrated that deletion of atpI led to reduced stability of the ATP synthase rotor and reduced membrane association of the F1 domain, suggesting that atpI plays a role in stabilizing the interface between the membrane-embedded F0 and the cytoplasmic F1 portions of ATP synthase .

What expression systems are most effective for producing recombinant B. subtilis atpI?

Several expression systems have proven effective for recombinant atpI production, each with distinct advantages:

  • E. coli-based systems:

    • pET series vectors (particularly pET3a and pET20b) have been successfully used for atpI expression

    • Addition of C-terminal affinity tags (His-tag or Strep-tag) facilitates purification while maintaining function

    • BL21(DE3) strains or specialized C41/C43(DE3) strains designed for membrane proteins are recommended

  • Cell-free expression systems:

    • In vitro translation systems have successfully expressed functional ATP synthase components including atpI

    • These systems allow controlled reconstitution with lipids and avoid potential toxicity issues

    • Particularly useful for studying direct interactions with other ATP synthase components

  • Homologous B. subtilis expression:

    • Provides native membrane environment for proper folding

    • Useful when studying interactions with other B. subtilis proteins

    • Allows for complementation studies in atpI deletion strains

For optimal results, expression conditions should be carefully optimized with reduced induction temperature (16-20°C), moderate inducer concentrations, and extended expression times to promote proper membrane integration.

What are effective methods for purifying recombinant B. subtilis atpI?

Purification of recombinant B. subtilis atpI requires specialized approaches for membrane proteins:

Purification StepRecommended ApproachNotes
Membrane extractionGentle cell lysis (French press or sonication)Avoid excessive heat generation
Solubilizationn-Dodecyl-β-D-maltoside (DDM) at 1-2%Milder than SDS; preserves native structure
Affinity chromatographyNi-NTA for His-tagged constructsInclude low concentrations of detergent in all buffers
Secondary purificationSize exclusion chromatographySeparates monomeric protein from aggregates
Quality assessmentSDS-PAGE and Western blotVerify purity and integrity

Buffer composition is critical, with typical formulations including 25-50 mM Tris-HCl (pH 7.5-8.0), 150-300 mM NaCl, 5-10% glycerol, and detergent at concentrations above the critical micelle concentration . For functional studies, reconstitution into proteoliposomes or nanodiscs may be necessary to provide a lipid environment that supports native conformation.

How does recombinant B. subtilis atpI interact with ATP synthase components during assembly?

Studies in related bacteria have provided insights into atpI's interactions with ATP synthase components:

  • C-subunit interaction: AtpI directly interacts with c-subunits to facilitate their assembly into the c-ring rotor. In some species, atpI co-purifies with c-rings during affinity purification, demonstrating stable interaction .

  • Assembly sequence: The temporal sequence involves:

    • Initial binding of atpI to individual c-subunits

    • Facilitation of c-subunit oligomerization

    • Potential handoff to YidC family proteins for final membrane integration

  • Species-specific variations: The strength and necessity of atpI interactions vary between species. In P. modestum and A. woodii (Na+-coupled ATP synthases), atpI appears necessary for c-ring assembly, while in B. pseudofirmus OF4, c-rings form normally even without atpI .

  • Potential redundancy: In some systems, the function of atpI may partially overlap with YidC family proteins (SpoIIIJ and YqjG in B. subtilis), which are membrane protein insertases . This functional overlap might explain why atpI deletion is not lethal in some species.

Understanding these interactions is crucial for comprehending the ATP synthase assembly pathway and potentially manipulating it for biotechnological applications.

What is the relationship between atpI and YidC/OxaI/Alb3 family proteins in ATP synthase assembly?

The relationship between atpI and YidC family proteins represents an intriguing aspect of ATP synthase assembly with apparent contradictions between in vivo and in vitro studies:

  • Functional distinction: In B. pseudofirmus OF4, unlike YidC homologs (SpoIIIJ and YqjG), atpI could not complement a YidC-depleted E. coli strain, indicating distinct functions despite some potential overlap in ATP synthase assembly .

  • In vitro versus in vivo requirements:

    • In vitro studies demonstrated c-ring formation with only atpI, without YidC homologs

    • In vivo studies suggest incorporation of c-subunits depends on YidC family proteins

    • This discrepancy may result from artificial conditions in plasmid-based expression systems

  • Essentiality patterns:

    • B. subtilis has two YidC homologs (YqjG and SpoIIIJ) and can survive with deletion of either one but not both

    • This contrasts with atpI, which can be deleted with less severe consequences

  • Evolutionary implications: The varying dependencies on atpI versus YidC proteins across bacterial species suggest potential evolutionary adaptations in the ATP synthase assembly pathway.

This complex relationship suggests a model where atpI may act earlier in the assembly process, possibly helping to nucleate c-ring formation, while YidC family proteins may be more important for membrane integration and final assembly steps.

How do mutations in the atpI gene affect ATP synthase assembly and function in B. subtilis?

Studies in related bacteria provide insights into how atpI mutations affect ATP synthase assembly:

  • Complete deletion effects: In B. pseudofirmus OF4, deletion of atpI led to:

    • Reduced stability of the ATP synthase rotor

    • Reduced membrane association of the F1 domain (34% reduction in membrane-associated β subunit)

    • Reduced ATPase activity

    • Modestly reduced nonfermentative growth

  • Notably, deletion did not completely eliminate ATP synthase function - the strain could still grow nonfermentatively, and the purified ATP synthase had a c-ring of normal size .

  • Domain-specific mutations: While the search results don't provide specific information on point mutations in B. subtilis atpI, structure-function studies would likely reveal:

    • Transmembrane domain mutations affecting interaction with c-subunits

    • Surface residue mutations impacting protein-protein interactions during assembly

    • Mutations affecting protein stability and membrane integration

  • System-specific effects: The search results suggest atpI may be more crucial for Na+-coupled ATP synthases than for H+-coupled systems . This indicates that mutations might have different severity depending on the coupling ion used by the ATP synthase.

Understanding the impact of specific mutations provides valuable insights into the molecular mechanism of atpI function and could guide engineering efforts to enhance ATP synthase assembly efficiency.

What techniques are most effective for studying interactions between recombinant atpI and ATP synthase components?

Multiple complementary techniques can effectively characterize interactions between atpI and ATP synthase components:

  • Co-purification approaches:

    • Affinity purification of tagged atpI followed by identification of interacting partners

    • The search results describe successful co-purification of c-rings with His-tagged atpI

    • Western blotting or mass spectrometry to identify co-purifying proteins

  • In vitro reconstitution systems:

    • Cell-free expression systems combining recombinant atpI with other ATP synthase components

    • Assessment of assembly intermediates and final complex formation

    • These systems have been successfully used to study the role of atpI in c-ring assembly

  • Crosslinking strategies:

    • Chemical crosslinking to capture transient interactions

    • Site-specific photocrosslinking to map interaction interfaces

    • Mass spectrometry analysis of crosslinked complexes

  • Biophysical interaction methods:

    • Surface plasmon resonance to determine binding kinetics

    • Microscale thermophoresis for solution-based interaction studies

    • Isothermal titration calorimetry for thermodynamic parameters

  • Structural approaches:

    • Cryo-electron microscopy of atpI-containing assembly intermediates

    • NMR spectroscopy for dynamics studies of specific interactions

The combination of these approaches provides a comprehensive understanding of how atpI interacts with ATP synthase components and facilitates assembly.

How can researchers effectively design experiments to study the functional role of atpI in ATP synthase assembly?

Designing rigorous experiments to study atpI function requires careful consideration of multiple factors:

  • Genetic approaches:

    • Creation of clean deletion mutants (ΔatpI) in B. subtilis

    • Complementation studies with wild-type and mutant versions

    • Construction of conditional expression systems for essential genes

  • Biochemical characterization:

    • Membrane fraction analysis to assess ATP synthase stability and assembly

    • ATPase activity measurements to evaluate functional consequences

    • Analysis of F1 domain distribution between membrane and cytoplasmic fractions

  • Protein-protein interaction studies:

    • Co-expression of atpI with c-subunits to assess complex formation

    • Pull-down assays to identify interaction partners

    • Analysis of stability and stoichiometry of formed complexes

  • Comparative approaches:

    • Parallel studies with atpI from H+-coupled and Na+-coupled ATP synthases

    • Analysis of functional overlap with YidC family proteins (SpoIIIJ and YqjG)

    • Evaluation of species-specific differences in atpI requirement

  • Controls and validations:

    • Include both positive controls (wild-type) and negative controls (deletion mutants)

    • Validate functionality of tagged protein versions

    • Use multiple independent techniques to confirm key findings

By systematically addressing these aspects, researchers can generate robust data on atpI function while avoiding common pitfalls in experimental design.

What are effective strategies for introducing site-directed mutations in recombinant B. subtilis atpI?

Site-directed mutagenesis of atpI requires strategic planning to generate informative mutants:

  • Target selection strategy:

    • Conserved residues identified through multiple sequence alignment

    • Predicted transmembrane domains that may interact with c-subunits

    • Charged or polar residues within hydrophobic regions

    • Regions showing evolutionary co-variation with c-subunits

  • Technical approaches:

    • QuikChange site-directed mutagenesis for single mutations

    • Gibson Assembly for multiple mutations or domain swaps

    • Golden Gate Assembly for systematic mutation libraries

  • Mutation categories to consider:

    • Conservative substitutions to test specific chemical properties

    • Charge reversals to disrupt electrostatic interactions

    • Alanine scanning to identify essential residues

    • Introduction of bulky residues to disrupt specific interactions

  • Validation of mutant proteins:

    • Expression level and stability assessment

    • Membrane integration verification

    • Secondary structure confirmation (CD spectroscopy)

    • Functional complementation testing

  • Systematic analysis approach:

Mutation TypeExamplesPurposeAnalysis Methods
ConservativeK→R, D→ETest charge importanceComplementation, binding assays
Non-conservativeK→A, D→AIdentify essential residuesATP synthase assembly, ATPase activity
Domain swapsB. subtilis/P. modestum chimerasDefine functional domainsCross-species complementation
Cysteine insertionVarious positionsEnable crosslinking studiesDisulfide mapping of interactions

This systematic approach to mutagenesis can provide detailed insights into the structural basis of atpI function in ATP synthase assembly.

What assays can reliably measure the chaperone-like activity of recombinant atpI in ATP synthase assembly?

Several complementary assays can effectively measure the chaperone-like activity of atpI:

  • In vitro c-ring assembly assay:

    • Co-expression of atpI with c-subunits in cell-free systems

    • Analysis of c-ring formation by native PAGE or size exclusion chromatography

    • Comparison of assembly efficiency with and without atpI

    • Quantification of properly formed c-rings versus aggregates

  • ATP synthase stability assessment:

    • Isolation of ATP synthase complexes from wild-type and ΔatpI strains

    • Exposure to increasing temperatures or denaturants

    • Measurement of activity retention and complex integrity

    • Analysis of subunit stoichiometry in purified complexes

  • F1-F0 association assay:

    • Quantification of F1 subunits in membrane versus cytoplasmic fractions

    • The search results show deletion of atpI in B. pseudofirmus led to reduced membrane association of the F1 domain and increased cytoplasmic F1

    • Western blot analysis using antibodies against F1 subunits (typically β)

  • Membrane reconstitution assays:

    • Incorporation of newly synthesized c-subunits into liposomes

    • Comparison of incorporation efficiency with and without atpI

    • Analysis of oligomeric state of incorporated c-subunits

  • Growth-based functional assays:

    • Complementation of growth defects in atpI deletion strains

    • Assessment of growth under conditions requiring ATP synthase function

    • Measurement of ATP synthesis rates in membrane vesicles

These assays collectively provide multiple lines of evidence for the chaperone-like function of atpI in facilitating proper ATP synthase assembly.

How can researchers verify that recombinant atpI is correctly integrated into membranes?

Verifying proper membrane integration of recombinant atpI is crucial for functional studies:

  • Membrane fractionation analysis:

    • Cell disruption followed by differential centrifugation

    • Separation of membrane and soluble fractions

    • Western blot analysis to detect atpI distribution

    • Functional atpI should predominantly localize to the membrane fraction

  • Protease accessibility assays:

    • Treatment of membrane vesicles with proteases (e.g., trypsin, proteinase K)

    • Analysis of protected versus digested regions

    • Mapping of membrane topology based on protease protection patterns

    • Comparison with predicted transmembrane topology

  • Detergent extraction profile:

    • Systematic testing of different detergents (mild to harsh)

    • Properly integrated membrane proteins require specific detergents for extraction

    • Analysis of extraction efficiency and retention of functional properties

    • Correlation between extraction conditions and functional activity

  • Fluorescence-based approaches:

    • GFP fusion constructs to visualize membrane localization

    • FRET between fluorescently labeled atpI and established membrane markers

    • Fluorescence microscopy to confirm membrane association pattern

    • Photobleaching studies to assess mobility within the membrane

  • Functional reconstitution:

    • Incorporation of purified atpI into liposomes or nanodiscs

    • Verification of function in the reconstituted system

    • Assessment of proper orientation in reconstituted membranes

These approaches provide complementary evidence for proper membrane integration and can identify misfolded or aggregated forms of the protein.

What strategies can overcome poor expression of recombinant B. subtilis atpI in heterologous systems?

Poor expression of membrane proteins like atpI is a common challenge that can be addressed through multiple strategies:

  • Expression optimization:

    • Reduced induction temperature (16-20°C) to slow folding and prevent aggregation

    • Lower inducer concentration to prevent overwhelming the membrane insertion machinery

    • Extended expression time (overnight to 24 hours) to allow proper membrane integration

    • Auto-induction media to provide gradual induction

  • Vector modifications:

    • Test different promoter strengths (T7, trc, ara)

    • Optimize the ribosome binding site sequence and spacing

    • Include fusion partners known to enhance membrane protein expression (MBP, SUMO)

    • The search results mention successful use of pTrc99A and pET series vectors

  • Host strain selection:

    • C41/C43(DE3) strains specifically developed for membrane protein expression

    • Lemo21(DE3) for tunable expression of membrane proteins

    • BL21-AI for tighter expression control with dual promoter regulation

  • Genetic modifications:

    • Codon optimization for the expression host

    • Removal of rare codons, particularly at the N-terminus

    • Silent mutations to eliminate RNA secondary structures

    • Fusion to signal sequences that enhance membrane targeting

  • Alternative expression systems:

    • Cell-free expression systems specialized for membrane proteins

    • The search results mention successful in vitro expression of ATP synthase components

    • Yeast or insect cell systems for eukaryotic expression

    • Homologous expression in B. subtilis

These strategies should be systematically tested using small-scale cultures before scaling up to larger preparations.

How can researchers troubleshoot issues with ATP synthase assembly assays involving recombinant atpI?

When troubleshooting ATP synthase assembly assays with recombinant atpI, researchers should consider these common issues and solutions:

  • Protein stability and degradation:

    • Include protease inhibitors in all buffers

    • Maintain samples at 4°C throughout preparation

    • Add reducing agents if using cysteine-containing constructs

    • Consider testing stability at different pH values

  • Insufficient c-ring formation:

    • Optimize protein expression ratios (atpI:c-subunit)

    • Provide appropriate lipid environment for assembly

    • Ensure proper membrane/detergent environment

    • The search results indicate that expression levels can significantly impact assembly efficiency

  • Non-specific aggregation:

    • Include mild detergents to prevent hydrophobic aggregation

    • Use sucrose gradient centrifugation to separate aggregates

    • Optimize salt concentration to reduce non-specific interactions

    • Control protein concentration to prevent supersaturation

  • Poor detection sensitivity:

    • Use sensitive detection methods (fluorescent labels, radiolabeling)

    • Optimize antibodies for Western blotting

    • Consider mass spectrometry for complex component identification

    • Use multiple detection methods to confirm results

  • Inconsistent results between experiments:

    • Standardize protein preparations and storage conditions

    • Use internal controls for normalization

    • Ensure consistent lipid:protein ratios in reconstitution experiments

    • Develop quantitative assays with appropriate statistical analysis

  • Insufficient functional validation:

    • Include both structural and functional assessments

    • Correlate assembly state with ATPase activity

    • Perform complementation studies in deletion strains

    • Compare results with published data from related systems

Systematic troubleshooting focusing on these aspects can significantly improve the reliability and reproducibility of ATP synthase assembly assays.

What are the most common pitfalls in designing experiments to study the role of atpI in ATP synthase assembly?

Researchers should be aware of several common pitfalls when studying atpI function:

Awareness of these pitfalls allows researchers to design more robust experiments with appropriate controls and validation steps.

How can researchers distinguish between specific effects of atpI on ATP synthase assembly and non-specific membrane protein folding assistance?

Distinguishing specific from non-specific effects requires carefully designed experiments:

  • Specificity controls:

    • Test effects on unrelated membrane proteins as negative controls

    • Compare with general membrane protein chaperones (e.g., YidC)

    • Analyze specificity of binding interactions using competition assays

    • Examine effects on proteins with similar topology but different functions

  • Structure-function analysis:

    • Identify mutations that specifically affect c-subunit interactions

    • Create chimeric proteins with domains from related proteins

    • Map binding interfaces through crosslinking or mutagenesis

    • Correlate specific structural features with functional outcomes

  • Timing and localization studies:

    • Determine when during ATP synthase assembly atpI is involved

    • Analyze co-localization with assembly intermediates

    • Use pulse-chase experiments to track assembly progression

    • Examine effects on different stages of the assembly process

  • Comparative analysis:

    • Compare effects on H+-ATP synthase versus Na+-ATP synthase

    • The search results suggest differential requirements between these systems

    • Analyze species-specific differences in atpI function

    • Correlate atpI properties with ATP synthase characteristics across species

  • Quantitative dose-response:

    • Titrate atpI levels and measure assembly efficiency

    • Determine stoichiometry of atpI:c-subunit interactions

    • Compare concentration dependencies with non-specific chaperones

    • True specific effects should show saturable binding kinetics

These approaches collectively can distinguish specific functions in ATP synthase assembly from general membrane protein folding assistance.

What emerging technologies could advance our understanding of atpI function in ATP synthase assembly?

Several cutting-edge technologies hold promise for deeper insights into atpI function:

  • Cryo-electron microscopy advances:

    • High-resolution structures of atpI-c-ring complexes

    • Time-resolved cryo-EM to capture assembly intermediates

    • Correlative light and electron microscopy to track assembly in cells

    • Tomographic approaches to visualize assembly in native membranes

  • Single-molecule techniques:

    • FRET-based sensors to monitor protein-protein interactions in real-time

    • Single-molecule tracking of fluorescently labeled atpI in live cells

    • Optical tweezers to measure interaction forces between components

    • Super-resolution microscopy to visualize assembly dynamics

  • Mass spectrometry innovations:

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • Native mass spectrometry of membrane protein complexes

    • Crosslink-MS to identify proximal residues during assembly

    • Quantitative proteomics to monitor assembly intermediates

  • Artificial intelligence applications:

    • AlphaFold2 and RoseTTAFold for structure prediction

    • Machine learning to identify patterns in assembly pathways

    • Automated image analysis for high-throughput screening

    • Computational models of assembly energetics

  • Synthetic biology approaches:

    • Minimal reconstituted systems to define essential components

    • Designer ATP synthases with modified c-rings

    • Biosensors reporting on assembly state in real-time

    • Bottom-up assembly of functional ATP synthase complexes

These technologies, especially when used in combination, can provide unprecedented insights into the molecular mechanisms of atpI function in ATP synthase assembly.

How might understanding atpI function contribute to engineering improved ATP synthases for biotechnological applications?

Understanding atpI function could enable several biotechnological advances:

  • Enhanced heterologous expression:

    • Co-expression of atpI could improve yield and stability of recombinant ATP synthases

    • Particularly valuable for challenging expression systems

    • The search results indicate atpI increased ATP synthase yield in some systems

    • Could facilitate production of ATP synthases from diverse species

  • Designer ATP synthases:

    • Engineering atpI to modify c-ring assembly process

    • Control of c-ring stoichiometry to alter bioenergetic efficiency

    • Creation of hybrid ATP synthases with novel properties

    • Development of ATP synthases optimized for specific applications

  • Stable ATP synthase preparations:

    • Inclusion of atpI during purification to maintain complex integrity

    • Development of stabilized complexes for structural studies

    • Creation of ATP synthase variants with enhanced thermal stability

    • Improved shelf-life for ATP synthases in biotechnological applications

  • Medical and industrial applications:

    • Understanding bacterial ATP synthase assembly could identify new antibiotic targets

    • Development of inhibitors specifically targeting bacterial atpI function

    • Engineering ATP synthases for optimized function in biohybrid devices

    • Creation of custom bioenergetic systems for specific industrial processes

These applications highlight the potential translational impact of fundamental research on atpI function in ATP synthase assembly.

What computational approaches can advance our understanding of atpI function and evolution?

Computational methods offer powerful tools for studying atpI:

  • Evolutionary analysis:

    • Comprehensive phylogenetic analysis of atpI across bacterial species

    • Correlation with ATP synthase types (H+- vs Na+-coupled)

    • Identification of co-evolving residues between atpI and c-subunits

    • Analysis of selection pressures operating on different atpI domains

  • Molecular dynamics simulations:

    • Membrane-embedded simulations of atpI structure

    • Modeling of interactions with c-subunits and lipids

    • Effects of mutations on protein dynamics and stability

    • Prediction of binding energy landscapes

  • Systems biology approaches:

    • Network analysis of genetic interactions involving atpI

    • Integration with transcriptomic and proteomic data

    • Modeling of ATP synthase assembly pathways

    • Prediction of epistatic relationships with other assembly factors

  • Structure prediction:

    • AlphaFold2 and RoseTTAFold predictions of atpI structure

    • Protein-protein docking to predict interaction interfaces

    • Molecular modeling of assembly intermediates

    • Virtual screening for small molecules that modulate atpI function

  • Integrative modeling:

    • Combining experimental data with computational predictions

    • Multi-scale modeling from atomic to cellular levels

    • Prediction of emergent properties from molecular interactions

    • Development of testable hypotheses for experimental validation

These computational approaches can guide experimental work and provide insights that would be difficult to obtain through experimental methods alone.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.