Recombinant Bacillus subtilis ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus subtilis ATP Synthase Subunit b (atpF)

ATP synthase, also known as F0F1-ATPase, is an essential enzyme that produces adenosine triphosphate (ATP) in living cells . ATP is the primary energy currency in cells, fueling various biological processes . In Bacillus subtilis, ATP synthase comprises several subunits, including the subunit b (atpF) . The atpF subunit is a component of the F0 sector, which is embedded in the cell membrane and responsible for proton translocation .

Recombinant Bacillus subtilis ATP synthase subunit b (atpF) refers to the atpF subunit that is produced using recombinant DNA technology . This involves cloning the atpF gene from Bacillus subtilis into an expression vector and expressing it in a host organism, such as Escherichia coli, or in cell-free expression systems . The recombinant protein can then be purified and used for various research and industrial applications .

Structure and Function of ATP Synthase Subunit b (atpF)

The ATP synthase in Bacillus subtilis is composed of two main parts: the F0 sector and the F1 sector . The F0 sector contains the a, b, and c subunits, which form a proton channel across the cell membrane . The F1 sector consists of the α, β, γ, δ, and ε subunits, which are responsible for ATP synthesis .

The atpF subunit (subunit b) plays a crucial role in connecting the F0 and F1 sectors . It forms a stalk-like structure that stabilizes the ATP synthase complex and facilitates the transfer of energy from proton translocation to ATP synthesis . Specifically, the flow of protons through the F0 sector causes the rotation of the c subunits, which in turn drives the rotation of the γ subunit in the F1 sector . This rotation induces conformational changes in the α and β subunits, leading to the synthesis of ATP from adenosine diphosphate (ADP) and inorganic phosphate .

Cloning and Expression of Recombinant atpF

To produce recombinant atpF, researchers first clone the atpF gene from Bacillus subtilis. The gene is amplified using polymerase chain reaction (PCR) and then inserted into a plasmid vector . The vector is designed to contain elements that facilitate high-level expression of the atpF gene in the host organism .
E. coli is a commonly used host for recombinant protein production due to its rapid growth rate and well-characterized genetics . After transforming E. coli with the expression vector, the cells are cultured under conditions that induce the expression of the atpF gene . The recombinant atpF protein is then purified from the cell lysate using affinity chromatography or other purification techniques . Cell-free expression systems are also used to produce recombinant atpF . These systems allow for the synthesis of proteins without the need for living cells, offering advantages such as reduced degradation and increased yield .

Research Findings and Applications

Recombinant Bacillus subtilis ATP synthase subunit b (atpF) has been used in various research studies to investigate the structure, function, and regulation of ATP synthase. Some notable findings and applications include:

  • Structural Studies: Recombinant atpF can be used to determine the three-dimensional structure of the subunit, either alone or as part of the ATP synthase complex. X-ray crystallography and cryo-electron microscopy (cryo-EM) are common techniques used for this purpose . The structural information provides insights into the interactions between atpF and other subunits, as well as the mechanism of proton translocation and energy transfer .

  • Functional Studies: Recombinant atpF is used to study the role of the subunit in ATP synthesis and hydrolysis . By creating mutants of atpF and analyzing their effects on ATP synthase activity, researchers can identify key residues and domains that are essential for function . These studies help elucidate the molecular mechanisms underlying ATP synthesis and energy conservation.

  • Drug Discovery: ATP synthase is a target for developing new antibacterial drugs . Some drugs, such as bedaquiline, inhibit ATP synthase activity in Mycobacterium tuberculosis, the causative agent of tuberculosis . Recombinant atpF can be used in drug screening assays to identify compounds that specifically inhibit the Bacillus subtilis ATP synthase .

  • Biotechnology Applications: Recombinant atpF can be used in various biotechnology applications, such as biosensors and biofuel production. For example, ATP synthase-based biosensors can be developed to detect ATP levels in real-time . Recombinant atpF can also be used to enhance ATP production in biofuel-producing microorganisms .

Impact of BsuMI on ATP Synthase

The BsuMI restriction-modification system in Bacillus subtilis affects the expression of ATP synthase subunits . The absence of the BsuMI methylation modification group decreases the expression of cytochrome oxidase subunits, which weakens the oxidative phosphorylation pathway and promotes the glycolytic rate of cells, improving the distribution of ATP molecules into competence formation . Studies have indicated that the deletion of the BsuMI methylation group inhibits the oxidative phosphorylation pathway in Bacillus subtilis, and the inhibition is exacerbated in strains with the deleted BsuMI methylation subunit .

Genome Reduction and ATP Synthase

Genome-reduced strains of Bacillus subtilis retain the genes necessary for thiol oxidation, disulfide bond reduction, and disulfide bond isomerization . These strains have pathways for extracytoplasmic thiol reduction, which rely on the membrane-embedded CcdA protein and the membrane-bound extracytoplasmic thiol-reductases ResA and StoA . The presence of these pathways suggests that genome-reduced strains can maintain redox balance, which is important for the proper functioning of ATP synthase .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; BSU36850; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
atpF
Target Protein Sequence
MSQLPLELGLSFNGGDILFQLLAMLILLALLKKYALGPLLNIMKQREDHIAGEITSAEEK NKEAQQLIEEQRVLLKEARQESQTLIENAKKLGEKQKEEIIQAARAESERLKEAARTEIV KEKEQAVSALREQVASLSVMIASKVIEKELDEQAQEKLIQDYLKEVGESR
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase catalyzes ATP synthesis from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembraneous catalytic F(1) domain and the membrane-bound proton channel F(0) domain, linked by a central and peripheral stalk. ATP synthesis within the F(1) catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F(0) channel, forming part of the peripheral stalk and connecting F(1) to F(0).
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the genetic organization of the atp operon in Bacillus subtilis?

The B. subtilis atp operon contains nine genes coding for the subunits of F0F1 ATP synthase. The arrangement of these genes in the operon is identical to that of the atp operon from Escherichia coli and from three other Bacillus species. The F0 atp genes are atpBEF and code for subunits a, c, and b, respectively. The F1 atp genes are designated atpHAGDC and code for subunits δ, α, γ, β, and ε, respectively . Upstream from the atp operon is a palindromic sequence followed by seven T residues, which may function as a transcription terminator for the preceding upp gene .

How does B. subtilis ATP synthase differ functionally from other bacterial ATP synthases?

B. subtilis lives in an aerobic environment and its ATP synthase is primarily used to synthesize ATP rather than hydrolyze ATP, as is the case for bacteria such as E. coli . This functional specialization is reflected in its regulatory mechanisms. For instance, the ε subunit in B. subtilis F1-ATPase doesn't inhibit but rather activates the enzyme by relieving it from MgADP inhibition, which differs from E. coli . Additionally, while the general features of the eight subunits are conserved in B. subtilis ATPase, subunits α, β, and c are the best conserved across species, with the DCCD binding pocket in subunit c being particularly well conserved .

What are the methodological approaches for purifying and reconstituting functional recombinant B. subtilis ATP synthase?

The purification and reconstitution of B. subtilis F1F0 ATP synthase requires careful consideration of detergent selection, lipid composition, and buffer conditions. The F1F0 ATP synthase can be solubilized from membranes and reconstituted into proteoliposomes to study its energy-linked activities. For reconstitution, both wild-type and mutant lipids have been used to examine the effect of lipid composition on enzyme function .

Experimental protocols typically involve:

  • Membrane isolation through differential centrifugation

  • Detergent solubilization (typically using mild detergents like DDM or Triton X-100)

  • Purification through affinity chromatography or ion exchange

  • Reconstitution into liposomes with defined lipid composition

  • Functional assays measuring ATP synthesis, ATP hydrolysis, or ATP-Pi exchange activities

Research has shown that the uncoupler resistance observed in certain B. subtilis mutants does not result simply from a lipid effect on the synthase that can be mimicked in proteoliposomes containing the lipids of mutant strains with low enzyme concentrations .

How do mutations in the atpF gene affect ATP synthase assembly and function in B. subtilis?

Mutations in the atpF gene, which encodes subunit b of the F0 sector, can significantly impact the assembly and function of the ATP synthase complex. Deletions of different parts of the atp operon result in B. subtilis mutants unable to grow with succinate as the sole carbon and energy source, indicating impaired oxidative phosphorylation .

Key findings from atp operon deletion studies include:

  • Mutants synthesize ATP only through substrate-level phosphorylation

  • Mutants show decreased growth yield (43-56% of wild-type level)

  • Mutants exhibit decreased growth rate (61-66% of wild-type level)

  • These changes correlate with a twofold decrease of the intracellular ATP/ADP ratio

  • In the absence of oxidative phosphorylation, B. subtilis increases ATP synthesis through substrate-level phosphorylation, resulting in a twofold increase of by-product formation (mainly acetate)

The increased turnover of glycolysis in the mutant strains leads to increased synthesis of NADH, accounting for the observed stimulation of respiration rate associated with increased expression of genes coding for respiratory enzymes .

What techniques are most effective for structural characterization of recombinant B. subtilis ATP synthase subunit b?

Several complementary techniques have proven effective for structural characterization:

  • Cryo-electron microscopy (cryo-EM): This technique has been successfully used for bacterial ATP synthases, allowing researchers to build atomic models of the complex in different rotational states. For example, the Bacillus PS3 ATP synthase was imaged by cryo-EM to reveal the position of various subunits and the path of transmembrane proton translocation .

  • X-ray crystallography: This has been used for determining the structure of components of the complex, such as the F1-ATPase from Bacillus PS3, revealing that the three catalytic β subunits adopt 'open', 'closed', and 'open' conformations, which differ from the conformations seen in E. coli F1-ATPase .

  • Biochemical crosslinking: This approach can provide information about subunit interactions, particularly for membrane-spanning subunits that are difficult to study by other methods.

  • Site-directed mutagenesis coupled with functional assays: This method allows researchers to probe the roles of specific residues in the enzyme's function and has been instrumental in understanding the proton translocation pathway.

What is the relationship between purine metabolism and ATP synthase function in B. subtilis?

The purine metabolism network in B. subtilis intersects with ATP synthase function through several pathways that affect energy metabolism and precursor availability. Manipulations of purine metabolic networks have significant impacts on cellular energy status and ATP synthesis capacity.

For instance, deletion of genes involved in adenine metabolism (adeC and apt) can enhance riboflavin production, which is connected to ATP synthesis through the flavin adenine dinucleotide (FAD) cofactor . This effect appears to be mediated through the purine regulator PurR, as constructing adeC and apt deletion strains in a purR-deleted background eliminates the promoting effect .

Additionally, the deoxyribonucleoside triphosphate (dNTP) synthesis pathway competes for precursors with ATP synthesis. Downregulating the expression of ribonucleotide reductases (RNRs) encoded by nrdE and nrdF, which catalyze the reduction of ribonucleoside diphosphates (NDPs) to deoxyribonucleoside diphosphates (dNDPs), can affect ATP levels and energy metabolism .

How do regulatory mechanisms differ between B. subtilis ATP synthase and other bacterial ATP synthases?

Regulatory FeatureB. subtilis ATP SynthaseE. coli ATP SynthaseFunctional Implication
ε subunit functionActivates by relieving MgADP inhibitionInhibits ATP hydrolysisAdaptation to primarily synthetic role in B. subtilis
β subunit conformations'Open', 'closed', and 'open''Half-closed', 'closed', and 'open'Species-specific differences in inhibition by subunit ε
MgADP inhibitionStrong effectPresent but less pronouncedDifferent energy conservation strategies
Response to oxidative phosphorylation absenceIncreased substrate-level phosphorylation with acetate productionSimilar response but different magnitudeBoth species adapt metabolically but through slightly different mechanisms

These regulatory differences reflect the adaptation of B. subtilis ATP synthase to its ecological niche and metabolic requirements. The activation role of the ε subunit in B. subtilis, rather than inhibition as in E. coli, is particularly noteworthy as it suggests that B. subtilis has evolved to optimize ATP synthesis rather than preventing wasteful ATP hydrolysis .

What are the common challenges in expressing recombinant B. subtilis atpF in heterologous systems?

Several challenges exist when expressing recombinant B. subtilis atpF in heterologous systems:

  • Protein folding and membrane insertion: As a membrane protein, subunit b requires proper folding and insertion into the membrane. Heterologous systems may lack specific chaperones or insertion machinery.

  • Toxicity: Overexpression of membrane proteins can be toxic to host cells due to membrane stress.

  • Assembly with other subunits: Subunit b must properly assemble with other F0 subunits for functionality. In heterologous systems, the stoichiometry and assembly process may be disrupted.

  • Post-translational modifications: Any required modifications may be absent in heterologous hosts.

  • Codon usage bias: Differences in codon usage between B. subtilis and the host organism can limit expression efficiency.

Strategies to overcome these challenges include:

  • Using codon-optimized synthetic genes

  • Employing inducible promoters with tight regulation

  • Co-expressing multiple subunits to facilitate proper assembly

  • Including fusion tags to aid in folding and purification

  • Testing multiple expression conditions (temperature, induction time, media composition)

How can researchers assess the functionality of recombinant B. subtilis ATP synthase subunit b?

Functionality assessment of recombinant subunit b requires both in vitro and in vivo approaches:

In vitro assays:

  • ATP synthesis activity in reconstituted proteoliposomes

  • ATP hydrolysis activity measurements

  • ATP-Pi exchange assays to measure the reversibility of the reaction

  • Proton pumping assays using pH-sensitive fluorescent dyes

  • Binding assays with other subunits to confirm proper interaction

In vivo assessments:

  • Complementation of B. subtilis atpF mutants (test if the recombinant protein can restore growth on non-fermentable carbon sources like succinate)

  • Measurements of intracellular ATP/ADP ratios

  • Assessment of growth rates and yields compared to wild-type strains

  • Analysis of by-product formation (e.g., acetate production)

  • Monitoring of respiration rates

When analyzing these assays, researchers should consider that in the absence of oxidative phosphorylation, B. subtilis increases ATP synthesis through substrate-level phosphorylation, showing a twofold increase in by-product formation (mainly acetate) .

What experimental controls are essential when studying recombinant B. subtilis ATP synthase subunit b?

Essential experimental controls include:

  • Wild-type B. subtilis ATP synthase: Serves as a positive control for activity and assembly.

  • ATP synthase lacking subunit b: Demonstrates the specific contribution of subunit b to the observed phenotypes.

  • Catalytically inactive mutants: Helps distinguish between effects due to protein presence versus activity.

  • E. coli ATP synthase: Provides a comparative reference for bacterial ATP synthases with different regulatory properties.

  • Inhibitor controls:

    • N,N'-dicyclohexylcarbodiimide (DCCD): Inhibits F0 function

    • Oligomycin: Inhibits ATP synthase activity

    • Carbonyl cyanide m-chlorophenyl hydrazone (CCCP): Dissipates proton gradient

  • Membrane integrity controls: Ensures that observed effects aren't due to membrane disruption.

  • Expression level controls: Confirms that phenotypic differences aren't simply due to different protein levels.

These controls are crucial for interpreting results correctly, especially when comparing wild-type and mutant forms or when evaluating the effects of different experimental conditions .

How should researchers interpret changes in ATP/ADP ratio when studying B. subtilis ATP synthase mutations?

When interpreting changes in ATP/ADP ratios:

  • Baseline comparison: First establish the normal ATP/ADP ratio in wild-type B. subtilis under your specific growth conditions. Research has shown that ATP synthase mutants typically exhibit a twofold decrease in the intracellular ATP/ADP ratio compared to wild-type .

  • Growth phase considerations: ATP/ADP ratios vary significantly with growth phase. Always compare samples from the same growth phase.

  • Carbon source effects: The choice of carbon source significantly impacts the ATP/ADP ratio. On fermentable substrates, ATP synthase mutants maintain higher ratios than on non-fermentable substrates like succinate, where they typically cannot grow .

  • Metabolic compensation: A decreased ATP/ADP ratio often triggers compensatory mechanisms, including increased substrate-level phosphorylation and by-product formation (particularly acetate). This compensation partially masks the full impact of ATP synthase deficiency .

  • Connection to growth parameters: Correlate ATP/ADP ratio changes with growth yield and growth rate. B. subtilis atp mutants show decreased growth yield (43-56% of wild-type) and decreased growth rate (61-66% of wild-type), correlating with the decreased ATP/ADP ratio .

What approaches can resolve contradictory findings between in vitro and in vivo studies of recombinant ATP synthase function?

Resolving contradictions between in vitro and in vivo studies requires systematic investigation:

  • System complexity reconciliation:

    • In vitro systems lack the full cellular context, including metabolic networks and regulatory mechanisms

    • Perform intermediate complexity studies using inverted membrane vesicles that maintain native membrane environment but allow experimental manipulation

  • Protein-lipid interaction analysis:

    • Membrane lipid composition affects ATP synthase function

    • Test reconstitution in different lipid environments that better mimic native membranes

    • Compare results in wild-type versus mutant lipids to identify lipid-dependent effects

  • Concentration and stoichiometry correction:

    • In vitro studies often use non-physiological protein concentrations

    • Titrate protein concentrations to identify concentration-dependent effects

    • Ensure proper stoichiometry of all subunits

  • Post-translational modification assessment:

    • Compare post-translational modification status between native and recombinant proteins

    • Introduce site-specific modifications to test their functional impact

  • Combined approaches:

    • Use genetic complementation to express modified proteins in vivo

    • Perform structure-function studies with site-directed mutagenesis

    • Apply single-molecule techniques to bridge the gap between bulk in vitro measurements and cellular context

These approaches have successfully resolved contradictions in studies of uncoupler resistance in B. subtilis mutants, showing that the resistance does not result simply from a lipid effect on the synthase that can be mimicked in proteoliposomes .

How can researchers distinguish between direct effects on ATP synthase and indirect metabolic effects when studying atpF mutations?

Distinguishing direct from indirect effects requires multi-level analysis:

  • Targeted biochemical assays:

    • Purify the ATP synthase complex and perform direct activity measurements

    • Compare wild-type and mutant forms in identical biochemical environments

    • Use reconstitution systems to control the environment precisely

  • Genetic approaches:

    • Create precise point mutations rather than gene deletions to minimize pleiotropic effects

    • Perform complementation studies with wild-type atpF to confirm phenotype reversibility

    • Use suppressor mutation analysis to identify interacting components

  • Metabolic flux analysis:

    • Track changes in central carbon metabolism using 13C-labeled substrates

    • Measure by-product formation (especially acetate) as B. subtilis increases substrate-level phosphorylation in the absence of oxidative phosphorylation

    • Monitor NADH/NAD+ ratios and respiration rates to detect compensatory mechanisms

  • Time-resolved studies:

    • Perform time-course experiments to distinguish primary from secondary effects

    • Early changes are more likely to be direct consequences of ATP synthase dysfunction

  • Comparative analysis across multiple mutants:

    • Compare atpF mutants with mutations in other ATP synthase subunits

    • Include mutants affecting related metabolic pathways to develop a signature profile for ATP synthase-specific effects

Research has shown that B. subtilis atp mutants exhibit increased turnover of glycolysis, leading to increased synthesis of NADH and stimulation of respiration rate, which are indirect metabolic adaptations to ATP synthase deficiency .

What emerging technologies might advance research on B. subtilis ATP synthase structure and function?

Several cutting-edge technologies show promise for advancing our understanding:

  • Cryo-electron tomography (cryo-ET): Enables visualization of ATP synthase in its native membrane environment without isolation, potentially revealing native interactions and organization.

  • Single-molecule techniques:

    • Single-molecule FRET to track conformational changes during catalysis

    • Magnetic tweezers to measure forces generated during ATP synthesis/hydrolysis

    • Nanodiscs combined with single-molecule spectroscopy to study the enzyme in a defined membrane environment

  • Mass spectrometry innovations:

    • Native mass spectrometry to determine subunit stoichiometry and interactions

    • Hydrogen-deuterium exchange mass spectrometry to probe dynamic conformational changes

    • Crosslinking mass spectrometry to map subunit interfaces

  • CRISPR-based approaches:

    • CRISPRi for precise downregulation of ATP synthase genes

    • High-throughput CRISPR screens to identify genetic interactions

    • Base editing for precise introduction of point mutations

  • Computational methods:

    • Molecular dynamics simulations of the entire ATP synthase complex

    • Machine learning approaches to predict functional consequences of mutations

    • Systems biology models integrating ATP synthase function with cellular metabolism

The application of cryo-EM has already yielded valuable insights into the structure of bacterial ATP synthases, revealing the position of subunit ε and how it inhibits ATP hydrolysis while allowing ATP synthesis .

How might research on B. subtilis ATP synthase inform the development of novel antimicrobial strategies?

B. subtilis ATP synthase research could inform antimicrobial development through several avenues:

  • Structural differences exploitation:

    • Identify structural differences between bacterial and human ATP synthases

    • Target unique regions of bacterial subunits, particularly in the membrane F0 sector

    • Develop compounds that specifically bind to bacterial ATP synthase without affecting the human enzyme

  • Regulatory mechanism targeting:

    • Exploit the unique regulatory role of the ε subunit in B. subtilis, which activates rather than inhibits the enzyme

    • Design molecules that interfere with relief of MgADP inhibition

    • Develop compounds that lock the enzyme in inhibited conformations

  • Metabolic vulnerability uncovering:

    • Target the compensatory mechanisms that B. subtilis employs when ATP synthase function is compromised

    • Develop combination therapies that simultaneously inhibit ATP synthase and substrate-level phosphorylation

    • Exploit the connection between ATP synthase and purine metabolism pathways

  • Novel screening platforms:

    • Use recombinant B. subtilis ATP synthase for high-throughput screening of inhibitor compounds

    • Develop whole-cell assays based on ATP synthase activity

    • Create reporter systems that indicate ATP synthase dysfunction

  • Cross-species comparative approaches:

    • Compare ATP synthases across different bacterial pathogens to identify conserved targets

    • Use B. subtilis as a model system for testing compounds against gram-positive pathogens

    • Identify species-specific vulnerabilities by comparing with E. coli and other bacteria

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.