Recombinant Bacillus subtilis Branched-chain amino acid transport protein AzlD (azlD)

Shipped with Ice Packs
In Stock

Description

Introduction to AzlD

AzlD is a hydrophobic protein encoded by the azlD gene in Bacillus subtilis. It functions as part of the bipartite AzlCD complex, which exports branched-chain amino acids (BCAAs) and other amino acids, including histidine, from the bacterial cytoplasm . The azlD gene is part of the azlBCDEF operon, regulated by the Lrp-like transcriptional repressor AzlB . Mutations in azlB disrupt repression, leading to overexpression of AzlC and AzlD, which confer resistance to toxic amino acids like 4-azaleucine and histidine .

Functional Role and Substrate Specificity

AzlD operates in tandem with AzlC to form an efflux transporter. Key findings include:

  • Primary Function: Export of BCAAs (leucine, isoleucine, valine) and non-proteogenic amino acids (e.g., histidine) .

  • Mechanism: The AzlCD complex facilitates substrate extrusion via an energy-dependent process, reducing intracellular toxicity .

  • Substrate Range:

    Amino AcidTransport EvidenceSource
    LeucineOperon regulation
    IsoleucineOperon regulation
    ValineOperon regulation
    HistidineDirect export
    2,3-Diaminopropionic acidIndirect export

Regulatory Mechanisms

AzlD expression is tightly controlled by AzlB, an Lrp-family repressor:

  • Negative Regulation: AzlB binds to the azlBCDEF promoter, repressing transcription under normal conditions .

  • Induction Mechanisms:

    • Mutations in azlB: Frameshift or missense mutations abolish repressor function, causing constitutive expression of AzlCD .

    • Environmental Triggers: Overexpression occurs in response to toxic amino acid accumulation, enhancing efflux capacity .

Recombinant Production and Characterization

AzlD is commercially produced as a recombinant protein for research applications:

ParameterValueSource
Host SystemsE. coli, Yeast
Purity≥85% (SDS-PAGE)
TagHis-tag
Endotoxin Level<1.0 EU/μg
Storage BufferPBS
Stability-20°C to -80°C (long-term)

Recombinant AzlD retains functional activity when co-expressed with AzlC, enabling studies on amino acid transport kinetics .

Key Discoveries

  1. Histidine Export: AzlCD exports histidine, reducing intracellular toxicity and enabling growth under otherwise inhibitory conditions .

  2. Cross-Talk with Importers: AzlCD’s activity counteracts uptake by importers like AimA, AimB, and BrnQ, balancing amino acid homeostasis .

  3. Role in Stress Response: Overexpression of AzlCD in azlB mutants provides resistance to β-alanine and 2,3-diaminopropionic acid, highlighting its role in detoxification .

Experimental Validation

ExperimentObservationSource
azlB Mutant Strains5–10× overexpression of AzlCD
Histidine Export AssaysIncreased extracellular histidine
Amino Acid Toxicity TestsResistance to 4-azaleucine, β-alanine

Applications and Future Directions

  • Biotechnological Use: AzlD’s substrate promiscuity makes it valuable for engineering microorganisms to withstand amino acid toxicity in industrial processes .

  • Therapeutic Potential: Insights into AzlD-mediated detoxification could inform strategies to combat amino acid-related disorders .

  • Research Tools: Recombinant AzlD facilitates mechanistic studies on transporter oligomerization and substrate recognition .

References PubMed: azlB regulation and AzlC/D function. bioRxiv: AzlCD’s role in histidine export. Creative BioMart: Recombinant AzlC production. MyBioSource: AzlD recombinant protein specs. ASM Microbiology: Amino acid homeostasis and AexA/AzlCD interplay. PMC: azlB operon structure and AzlC/D overexpression. PMC: CodY regulation and BCAA transport. PubMed: Recombinant protein production in B. subtilis. ASM: azlB mutations and AzlCD overexpression.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. If you require dry ice shipping, please communicate with us beforehand. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
azlD; yrdI; BSU26700; Branched-chain amino acid transport protein AzlD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
azlD
Target Protein Sequence
MTMTMTQQMITIAMVVLGTMLTRFLPFMIFPSGKPTPKYVQYLGKVLPSAVIGLLVIYCL KDVSLLSGSHGIPELVGAAAVVLLHLWKKNMLLSIAGGTVVYMVLVQLVF
Uniprot No.

Target Background

Function
This protein is involved in the transport of branched-chain amino acids.
Database Links
Protein Families
AzlD/HI_1737/HP1330 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is AzlD and what is its function in Bacillus subtilis?

AzlD is a novel hydrophobic protein encoded as part of the azlBCDEF operon in Bacillus subtilis. Based on genetic and functional analyses, it is involved in branched-chain amino acid transport across the bacterial cell membrane . The protein functions in concert with AzlC, another hydrophobic protein encoded in the same operon. The evidence for AzlD's transport function comes from studies showing that overproduction of AzlC and AzlD confers resistance to 4-azaleucine, a toxic analog of leucine . This resistance phenotype strongly suggests these proteins either prevent uptake of the toxic compound or enhance its export from the cell.

Methodological approach: To confirm AzlD's role in transport, researchers typically employ gene knockout studies followed by growth assays in media containing various branched-chain amino acids or toxic analogs. Complementation experiments, where the wild-type gene is reintroduced into a deletion mutant, are essential to verify that observed phenotypes are directly attributable to the absence of AzlD.

How is azlD genetically organized within the B. subtilis genome?

The azlD gene is the third gene in the azlBCDEF operon, positioned downstream of azlB and azlC . The genetic organization is as follows:

  • azlB: Encodes an Lrp-like transcriptional regulator

  • azlC: Encodes a hydrophobic protein that works with AzlD

  • azlD: Encodes the branched-chain amino acid transport protein

  • azlE: Function not specifically described in the available literature

  • azlF: Function not specifically described in the available literature

The azlB gene acts as a negative regulator of the entire operon, repressing expression of itself and the downstream genes including azlD . This genetic arrangement ensures coordinated expression of all components necessary for the branched-chain amino acid transport system.

Methodological approach: Operon structure can be confirmed through techniques such as RT-PCR spanning adjacent genes, Northern blotting, or reporter gene fusions to individual genes within the proposed operon.

What structural features characterize the AzlD protein?

AzlD is described as a "novel hydrophobic protein," suggesting it contains significant hydrophobic domains that likely facilitate membrane association or integration . While detailed structural information is limited in the available literature, several features can be inferred:

  • Hydrophobic regions: Likely contains multiple transmembrane domains

  • Membrane association: Given its role in transport, AzlD is almost certainly an integral membrane protein

  • Interaction domains: Must contain regions that facilitate interaction with AzlC, as these proteins function together

Methodological approach: To characterize AzlD's structure, researchers would typically employ bioinformatic analyses (hydropathy plots, transmembrane domain prediction), biochemical approaches (membrane fractionation, protease accessibility), and structural biology techniques (X-ray crystallography or cryo-EM, though these are challenging for membrane proteins).

What experimental approaches are most effective for studying azlD expression and regulation?

Based on published research strategies, several approaches have proven effective for studying azlD expression and regulation:

  • Promoter-reporter fusions: The construction of transcriptional fusions between the azlB promoter and reporter genes such as lacZ has been successfully used to study expression patterns . Similar approaches could be applied specifically to azlD.

  • Deletion analysis: Truncation of the promoter region has helped identify regulatory elements. For example, studies showed that only 135 bp upstream of the azlB coding region are necessary to preserve complete activity and regulation of the azlB promoter .

  • Growth phase monitoring: Expression studies in different media have shown that azlB expression (and by extension, azlD expression) is modulated by growth phase, being induced during exponential growth and shut off at the beginning of stationary phase .

  • Medium composition effects: Expression is affected by nitrogen source - when ammonia was replaced by 0.2% proline in minimal glucose medium, azlB-lacZ expression was enhanced three- to four-fold . Addition of 0.2% Casamino Acids to glucose-ammonia medium activated expression six-fold .

Growth Conditionβ-Galactosidase Activity (Miller units) in wild-typeβ-Galactosidase Activity in ΔazlB2 mutant
TSS glucose-ammonia~5-10~250-300
DS nutrient broth~50-100~250-300
With proline instead of ammonia~20-40Not determined
With Casamino Acids~30-60Not determined

Note: Values estimated based on described fold changes in the literature

How does AzlD contribute to 4-azaleucine resistance in B. subtilis?

Resistance to 4-azaleucine (a toxic leucine analog) in azlB mutants is attributed to overproduction of AzlC and AzlD . The resistance mechanism likely involves one of the following:

  • Reduced uptake: AzlD and AzlC may form a transport system with altered substrate specificity that reduces the uptake of 4-azaleucine.

  • Enhanced export: Alternatively, these proteins might function in the export of the toxic compound from the cytoplasm.

Experimental evidence shows that deletion of azlB significantly increases resistance to 4-azaleucine, with the minimum inhibitory concentration (MIC) increasing from 5-10 μg/ml in wild-type strains to >200 μg/ml in azlB mutants . This phenotype is directly linked to the overproduction of AzlC and AzlD that occurs when the negative regulation by AzlB is removed.

Methodological approach: To study this phenomenon, researchers typically perform growth inhibition assays with varying concentrations of 4-azaleucine, comparing wild-type strains to various mutants (ΔazlB, ΔazlC, ΔazlD, and combinations). Transport assays using radiolabeled 4-azaleucine can directly measure uptake rates in different genetic backgrounds.

What is known about the interaction between AzlC and AzlD in transport function?

  • Complex formation: AzlC and AzlD may form a heterodimeric or heteromultimeric complex that constitutes the functional transport unit.

  • Complementary functions: The two proteins might perform distinct but complementary roles in the transport process (e.g., one binding the substrate while the other facilitates the conformational change needed for translocation).

  • Sequential action: They could act sequentially in a transport pathway, with one protein transferring the substrate to the other.

Methodological approach: To investigate these interactions, researchers would typically employ:

  • Co-immunoprecipitation or pull-down assays with tagged versions of the proteins

  • Bacterial two-hybrid or FRET-based interaction assays

  • Cross-linking studies followed by mass spectrometry

  • Genetic approaches such as suppressor screens or synthetic lethality assays

What are the optimal conditions for recombinant expression of functional AzlD?

Expressing functional recombinant AzlD presents challenges due to its hydrophobic nature and likely membrane localization. Based on general principles for membrane protein expression and the specific characteristics of AzlD, the following approach is recommended:

Expression system selection:

  • Homologous expression in B. subtilis offers the advantage of native membrane composition and processing machinery.

  • Heterologous expression in E. coli is more convenient but may require optimization of membrane insertion.

Vector design considerations:

  • Inducible promoters (e.g., IPTG-inducible Pspac in B. subtilis) allow controlled expression

  • Fusion tags:

    • N-terminal His6-tag for purification

    • Fluorescent protein fusions (e.g., GFP) to monitor expression and localization

    • Removable tags via TEV protease sites

Optimization parameters:

  • Induction conditions: Lower temperatures (16-20°C) often improve membrane protein folding

  • Media composition: Amino acid supplementation may enhance yields

  • Membrane extraction: Mild detergents (DDM, LMNG) typically preserve membrane protein structure

Functional verification:

  • Complementation assays in ΔazlD strains

  • 4-azaleucine resistance testing

  • Transport assays with labeled branched-chain amino acids

Methodological approach: A systematic optimization approach is recommended, testing multiple expression constructs and conditions in parallel, followed by functional assays to verify that the recombinant protein retains native activity.

How can systems biology approaches be applied to understand the role of AzlD in the broader context of B. subtilis metabolism?

Understanding AzlD in the broader metabolic context requires integrating multiple data types:

Multi-omics integration approaches:

  • Transcriptomics: Compare gene expression profiles between wild-type and ΔazlD strains under various nutrient conditions to identify affected pathways.

  • Proteomics: Quantify changes in the membrane proteome to identify potential interaction partners.

  • Metabolomics: Measure intracellular and extracellular branched-chain amino acid levels to quantify transport effects.

  • Fluxomics: Use 13C-labeled amino acids to track metabolic flux changes in ΔazlD strains.

Network analysis:

  • Construct protein-protein interaction networks centered on AzlD and AzlC

  • Develop metabolic models incorporating branched-chain amino acid transport

  • Identify regulatory networks affected by azlD deletion

Phenotypic profiling:

  • Growth phenotype microarrays under hundreds of conditions

  • Fitness contributions under different nutrient limitations

  • Competitive growth assays with labeled strains

Methodological approach: Design experiments that systematically perturb the system (gene deletions, environmental changes) while measuring multiple cellular parameters, then apply computational methods to integrate these diverse data types into coherent models.

What structure-function relationships are critical for AzlD activity and how can they be investigated?

Investigating structure-function relationships in AzlD requires a multifaceted approach combining computational prediction, mutagenesis, and functional assays:

Computational analysis:

  • Sequence alignment with homologous transporters to identify conserved residues

  • Hydropathy analysis to predict transmembrane domains

  • Homology modeling based on structurally characterized transporters

  • Molecular dynamics simulations to predict conformational changes

Mutagenesis strategy:

  • Alanine-scanning mutagenesis of predicted transmembrane domains

  • Targeted mutagenesis of conserved residues

  • Construction of chimeric proteins with related transporters

  • Domain swapping between AzlC and AzlD to identify functional regions

Functional characterization:

  • Transport assays with radiolabeled substrates

  • 4-azaleucine resistance testing

  • Protein localization using fluorescent fusions

  • Substrate binding assays with purified protein/domains

Proposed structure-function model:
Based on its role in branched-chain amino acid transport and interaction with AzlC, AzlD likely contains:

  • Substrate binding pocket with specificity for hydrophobic side chains

  • Transmembrane helices forming a transport channel

  • Interface regions for interaction with AzlC

  • Possibly regions sensing cellular energy status to couple transport to energy

Methodological approach: Begin with computational predictions to guide initial mutagenesis, then iteratively refine the structural model based on functional data from mutants. Ultimately, high-resolution structural determination via X-ray crystallography or cryo-EM would provide definitive structural information.

How can understanding AzlD function contribute to the development of B. subtilis as a protein expression host?

B. subtilis is increasingly used as a host for heterologous protein expression, including for vaccine antigens as mentioned in the third search result . Understanding AzlD function can enhance this application in several ways:

  • Improved nutrient uptake: Engineering strains with optimized branched-chain amino acid transport could enhance growth and protein production yields.

  • Metabolic balancing: Modulating AzlD expression could help balance amino acid availability with protein synthesis demands.

  • Resistance to toxic by-products: The mechanisms of 4-azaleucine resistance could be leveraged to develop strains resistant to toxic compounds generated during high-level protein expression.

  • Secretion enhancement: Knowledge of membrane transport systems like AzlD/AzlC could inform strategies to improve protein secretion.

Methodological approach: Systematic testing of B. subtilis strains with varying levels of AzlD/AzlC expression for their protein production capabilities under different conditions, followed by iterative strain optimization.

What techniques are most effective for monitoring the real-time dynamics of AzlD-mediated transport in live cells?

Advanced imaging and biosensor techniques provide opportunities to monitor AzlD-mediated transport in real-time:

  • Fluorescent amino acid analogs: Develop branched-chain amino acid analogs conjugated to environmentally-sensitive fluorophores.

  • FRET-based biosensors: Engineer protein sensors that undergo conformational changes upon binding branched-chain amino acids, positioned either in the periplasm or cytoplasm.

  • AzlD-fluorescent protein fusions: Create functional fusions that maintain transport activity while allowing visualization of protein localization and dynamics.

  • pH-sensitive indicators: If transport is coupled to proton movement, pH-sensitive fluorescent proteins can monitor local pH changes.

  • Microfluidic approaches: Combine with the above methods to precisely control the extracellular environment while monitoring cellular responses.

Methodological approach: Develop and validate multiple complementary approaches, as each has strengths and limitations. Begin with fluorescent protein fusions to establish localization patterns, then progress to more sophisticated biosensor approaches to measure actual transport activity.

How might azlD homologs in pathogenic bacteria be targeted for antimicrobial development?

If essential for pathogen survival, AzlD homologs could represent novel antimicrobial targets:

  • Target identification: Bioinformatic analysis to identify AzlD homologs in pathogenic species, followed by essentiality testing through gene deletion or CRISPRi approaches.

  • High-throughput screening: Development of assays measuring transport activity suitable for screening compound libraries.

  • Structure-based drug design: If structural information becomes available, rational design of inhibitors targeting substrate binding sites or protein-protein interaction interfaces.

  • Peptide inhibitors: Design of peptides that disrupt AzlD-AzlC interactions or interfere with transport function.

  • Competitive substrates: Development of non-toxic substrate analogs that compete for transport but cannot be metabolized.

Methodological approach: Begin with comprehensive bioinformatic analysis to identify and prioritize AzlD homologs in pathogens, validate their essentiality, then develop appropriate assay systems for inhibitor screening and characterization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.