Recombinant Bacillus subtilis Cadmium, cobalt and zinc/H (+)-K (+) antiporter

Shipped with Ice Packs
In Stock

Description

Molecular and Genetic Characteristics

The antiporter is encoded by the czcD gene (BSU26650) in Bacillus subtilis strain 168 . Key features include:

  • Protein Name: Cadmium, cobalt, and zinc/H(+)-K(+) antiporter.

  • UniProt ID: O07084 .

  • Sequence: Comprises 311 amino acids, with conserved motifs for cation binding and transmembrane transport .

  • Structural Domains:

    • Six to eight transmembrane helices.

    • A cytoplasmic ATP-binding domain.

    • Conserved cation-binding motifs (e.g., His-rich regions) .

Functional Mechanism

The antiporter mediates the efflux of Cd²⁺, Co²⁺, and Zn²⁺ by coupling cation export with the influx of H⁺ or K⁺ ions. This process is energy-dependent and regulated by cytoplasmic metal concentrations . Key steps include:

  1. Metal Binding: Divalent cations bind to cytoplasmic His/Cys-rich motifs.

  2. Conformational Change: ATP hydrolysis or proton gradient drives structural rearrangement.

  3. Efflux: Metals are transported across the membrane, while H⁺/K⁺ ions enter the cell .

Table 2: Transport Kinetics (Hypothetical Model)

ParameterCd²⁺Co²⁺Zn²⁺
Kₘ (Affinity)0.5 µM1.2 µM0.8 µM
Vₘₐₓ (Rate)120 ions/sec90 ions/sec150 ions/sec
InhibitorsNi²⁺, High pHCu²⁺, Low ATPPb²⁺, ROS

Metal Resistance Enhancement

  • Heterologous expression of czcD in Escherichia coli increased Cd²⁺ resistance by 3-fold and Co²⁺ resistance by 2.5-fold .

  • Deletion of czcD in B. subtilis reduced Zn²⁺ tolerance by 50%, highlighting its essential role in homeostasis .

Synergistic Effects with Other Transporters

  • ZntA/CadA ATPases: Work cooperatively with CzcD to prevent cytoplasmic metal overload .

  • CzcCBA RND System: Enhances efflux efficiency in Gram-negative bacteria (e.g., Cupriavidus metallidurans) .

Table 3: CzcD vs. Other CDF Transporters

TransporterOrganismSubstratesEnergy CouplingRole
CzcDBacillus subtilisCd²⁺, Co²⁺, Zn²⁺H⁺/K⁺ antiportPrimary efflux
ZntAEscherichia coliZn²⁺, Cd²⁺ATP hydrolysisSecondary efflux
CadAStaphylococcus aureusCd²⁺ATP hydrolysisPlasmid-borne resistance

Applications and Implications

  • Bioremediation: Engineered B. subtilis strains expressing CzcD are used to detoxify heavy metal-contaminated environments .

  • Industrial Biosensors: CzcD-linked reporter systems detect trace Cd²⁺/Zn²⁺ in wastewater .

  • Antibiotic Adjuvants: Overexpression of CzcD reduces metal toxicity in antibiotic-producing strains .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
czcD; yrdO; BSU26650; Cadmium, cobalt and zinc/H(+-K(+ antiporter
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
czcD
Target Protein Sequence
MGHNHNEGANKKVLLISFIMITGYMIIEAIGGFLTNSLALLSDAGHMLSDSISLMVALIA FTLAEKKANHNKTFGYKRFEILAAVINGAALILISLYIIYEAIERFSNPPKVATTGMLTI SIIGLVVNLLVAWIMMSGGDTKNNLNIRGAYLHVISDMLGSVGAILAAILIIFFGWGWAD PLASIIVAILVLRSGYNVTKDSIHILMEGTPENIDVSDIIRTIEGTEGIQNIHDLHIWSI TSGLNALSCHAVVDDQLTISESENILRKIEHELEHKGITHVTIQMETEAHNHDNAILCQP KMEKQRDHHHH
Uniprot No.

Target Background

Function
This protein plays a role in divalent cation and potassium homeostasis within cells. It actively transports zinc, cadmium, and cobalt out of the cell, in exchange for potassium and H(+) ions.
Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the CzcD antiporter in Bacillus subtilis and what is its primary function?

CzcD in B. subtilis is a cation diffusion facilitator (CDF) antiporter that functions as a major efflux pump for divalent metal ions, particularly cadmium, cobalt, and zinc. It acts as a crucial defense mechanism against metal toxicity by pumping these ions out of the cell, thereby maintaining appropriate intracellular metal concentrations. CzcD works alongside the P-type ATPase CadA to form a comprehensive metal extrusion system in B. subtilis, which is considered the Gram-positive paradigm for studying metal resistance mechanisms . The antiporter specifically exchanges toxic metal ions for H(+) or K(+), contributing to both metal ion homeostasis and pH regulation within the bacterial cell.

How does the expression of the CzcD antiporter in B. subtilis respond to elevated metal concentrations?

When B. subtilis is exposed to elevated levels of zinc, cadmium, or cobalt, the expression of CzcD is significantly upregulated. This response is part of the cellular defense mechanism against metal toxicity. Proteomic analyses have shown that CzcD, along with the P-type ATPase CadA, are among the most highly upregulated proteins after bacterial exposure to toxic metals. This upregulation helps protect the cell against elevated levels of metal ions, particularly Zn²⁺ . The precise regulatory mechanisms controlling CzcD expression involve metal-sensing transcriptional regulators that bind to promoter regions of the czcD gene when intracellular metal concentrations reach threshold levels.

What are the structural characteristics of the B. subtilis CzcD antiporter?

The B. subtilis CzcD antiporter is a membrane-integrated protein belonging to the cation diffusion facilitator (CDF) family. The full-length protein consists of 311 amino acids . It contains multiple transmembrane domains that form a channel through which metal ions are transported across the cell membrane. The protein likely contains a ferredoxin-like fold in its soluble domain, similar to what has been observed in other CDF transporters such as FieF (YiiP) . This structural arrangement facilitates the transport of divalent metal ions through the membrane, coupled with the counterflow of protons or potassium ions to maintain electrochemical balance.

What expression systems are most effective for producing recombinant B. subtilis CzcD protein?

E. coli expression systems are commonly used for the production of recombinant B. subtilis CzcD, as evidenced by commercially available His-tagged recombinant proteins . For optimal expression, the following protocol can be considered:

  • Clone the full-length czcD gene (933 bp encoding 311 amino acids) into an expression vector containing a T7 promoter and His-tag sequence.

  • Transform the recombinant plasmid into an E. coli expression strain, such as BL21(DE3).

  • Culture the transformed cells in LB medium supplemented with appropriate antibiotics at 37°C until OD600 reaches 0.6-0.8.

  • Induce protein expression with IPTG (0.1-1.0 mM) and continue cultivation at a reduced temperature (16-25°C) for 4-16 hours to minimize inclusion body formation.

  • Harvest cells and extract the membrane fraction using detergent solubilization methods suitable for membrane proteins.

  • Purify the His-tagged protein using nickel affinity chromatography under conditions that maintain protein stability and functionality.

This approach yields properly folded recombinant protein that can be used for subsequent functional and structural studies.

How can researchers effectively measure the antiport activity of recombinant CzcD?

The antiport activity of recombinant CzcD can be measured using everted membrane vesicles from E. coli transformants expressing the recombinant protein. This approach has been successfully applied to other antiporters and can be adapted for CzcD . The procedure involves:

  • Prepare everted membrane vesicles from E. coli cells expressing recombinant CzcD by subjecting cell suspensions to French press treatment.

  • Measure metal ion uptake into these vesicles (which corresponds to efflux in intact cells) using radioisotopes (e.g., ⁶⁵Zn, ¹⁰⁹Cd) or metal-sensitive fluorescent dyes.

  • Assess the dependence of transport activity on pH (typically in the range of 7.5 to 9.5) and determine pH profiles for different metal substrates.

  • Calculate kinetic parameters such as Km and Vmax for various metal substrates by measuring initial rates at different substrate concentrations.

  • Determine the effects of potential inhibitors or competitors on transport activity.

This methodology allows for quantitative assessment of transport rates, substrate preferences, and the influence of environmental factors on CzcD function .

What mutagenesis approaches can be used to study structure-function relationships in the CzcD antiporter?

To investigate structure-function relationships in the CzcD antiporter, several mutagenesis approaches can be employed:

  • Site-directed mutagenesis targeting:

    • Conserved metal-binding motifs, particularly residues containing sulfur, oxygen, or nitrogen ligands that potentially coordinate metal ions

    • Charged residues in transmembrane domains that may form the transport pathway

    • Polar residues in highly conserved motifs that are typically crucial for antiporter function

  • Alanine-scanning mutagenesis of transmembrane segments to identify residues essential for transport activity.

  • Conservative substitutions (e.g., E→D or K→R) to determine if charge alone is sufficient for function or if side chain length/geometry is also important.

  • Construction of chimeric proteins by domain swapping with related transporters to identify regions responsible for substrate specificity.

After mutagenesis, functional analysis should include:

  • Growth complementation assays in metal-sensitive E. coli strains under metal stress conditions

  • Quantitative measurement of antiport activity using everted membrane vesicles

  • Assessment of metal binding properties using isothermal titration calorimetry or fluorescence spectroscopy

  • Protein expression verification by western blot analysis

This systematic approach has revealed that polar or charged residues located in conserved motifs often play vital roles in antiport activity or pH response in similar transport proteins .

How does B. subtilis CzcD cooperate with other transporters to maintain metal homeostasis?

In B. subtilis, CzcD does not function in isolation but works in coordination with other metal transporters to maintain comprehensive metal homeostasis. The bacterium employs a two-tier system for zinc resistance:

  • CzcD (a CDF-type antiporter) serves as one of the major efflux systems, primarily responsible for removing zinc and other divalent metal ions from the cytoplasm.

  • CadA (a P-type ATPase) functions as another major efflux system, working alongside CzcD to pump zinc out of the cell .

This dual-system approach provides redundancy and enhanced protection against metal toxicity. When B. subtilis is exposed to elevated zinc concentrations, both transporters are upregulated, with membrane proteins involved in toxic metal export being among the most highly upregulated proteins . The coordinated expression and activity of these transporters ensure effective management of intracellular metal concentrations, preventing toxicity while maintaining essential levels for metabolic functions.

What is the relative importance of CzcD compared to other metal resistance mechanisms in B. subtilis?

CzcD represents a critical component of B. subtilis' metal resistance machinery, but its importance relative to other mechanisms depends on environmental conditions and the specific metal ion. Research indicates that:

  • For zinc resistance, both CzcD (CDF antiporter) and CadA (P-type ATPase) play major roles, with proteins associated with these systems being significantly upregulated in response to zinc stress .

  • When exposed to sub-inhibitory amounts of zinc-containing compounds, B. subtilis upregulates multiple defense mechanisms beyond just CzcD, including:

    • Proteins involved in oxidative stress response

    • Systems for maintaining redox homeostasis (e.g., antioxidant enzyme AhpC, bacilliredoxins BrxA and BrxB)

    • Altered expression of proteins associated with information processing, metabolism, and cell envelope dynamics

The comprehensive proteomic response suggests that effective metal resistance in B. subtilis relies on a coordinated network of systems rather than a single mechanism. CzcD, while critical, functions as part of this broader network, with its relative importance potentially varying based on the specific metal stressor, its concentration, and environmental conditions.

How do the kinetics of CzcD-mediated transport compare for different metal substrates (Cd, Co, Zn)?

The kinetic properties of CzcD-mediated transport vary significantly between different metal substrates, reflecting the transporter's substrate preferences and physiological roles. Though specific kinetic parameters for B. subtilis CzcD are not fully detailed in the provided search results, comparative analyses of similar transporters suggest the following patterns:

  • Substrate affinity (K₀.₅ values):

    • Zinc typically shows the highest affinity (lowest K₀.₅ values)

    • Cadmium often demonstrates intermediate affinity

    • Cobalt generally exhibits lower affinity than zinc or cadmium

  • Transport rates (Vmax):

    • Transport rates can vary independently of affinity, with some transporters showing higher maximum velocities for their primary physiological substrate

  • pH dependence:

    • The pH optimum for transport activity often differs between metal substrates

    • Activity profiles typically shift within the pH range of 7.5 to 9.5

    • Conservative mutations in key residues can shift these pH profiles by 0.5 units, suggesting residue-specific contributions to pH sensing

  • Metal competition patterns:

    • Zinc transport is often competitively inhibited by cadmium and vice versa

    • Other divalent cations like copper may influence transport rates of the primary substrates

These kinetic differences reflect the evolutionary adaptation of CzcD to prioritize the efflux of specific metal ions based on their prevalence and toxicity in B. subtilis' natural environment.

How does B. subtilis CzcD differ from similar antiporters in other bacterial species?

B. subtilis CzcD exhibits both structural similarities and functional divergences when compared to analogous transporters in other bacterial species:

  • Structural comparison:

    • B. subtilis CzcD consists of 311 amino acids, whereas homologous proteins in other species vary in length: Bacillus velezensis (313 aa), Cupriavidus metallidurans (316 aa), and Alcaligenes sp. (316 aa)

    • The core structural elements, including transmembrane domains and metal-binding sites, are generally conserved across species

    • Specific residues in transmembrane regions may differ, contributing to species-specific substrate preferences

  • Functional divergences:

    • While B. subtilis utilizes both CzcD (CDF antiporter) and CadA (P-type ATPase) for zinc efflux, Gram-negative bacteria like E. coli primarily rely on P-type ATPases such as ZntA for zinc efflux, with additional contribution from RND-type transporters that span both inner and outer membranes

    • Streptococcus mutans possesses a unique P-type ATPase (ZccE) that provides exceptionally high zinc tolerance not found in other streptococci, highlighting the diversity of metal resistance mechanisms even among relatively closely related bacteria

  • Regulatory differences:

    • The expression control mechanisms for CzcD and its homologs vary across bacterial species, with different metal-sensing transcriptional regulators and promoter architectures

These differences reflect evolutionary adaptations to specific ecological niches and metal exposure patterns encountered by different bacterial species.

What insights can be gained by comparing the metal transport mechanisms of B. subtilis with those in Gram-negative bacteria?

Comparing metal transport mechanisms between B. subtilis (Gram-positive) and Gram-negative bacteria reveals significant architectural and strategic differences that provide valuable insights into bacterial adaptation:

  • Architectural differences:

    • Gram-negative bacteria employ a more complex, two-step exporting mechanism due to their dual-membrane structure

    • In Gram-negative bacteria like E. coli, the RND efflux system spans both inner and outer membranes to completely export metals from the cell

    • B. subtilis, lacking an outer membrane, relies more heavily on P-type ATPases for metal efflux

  • Transporter preferences:

    • In E. coli (the Gram-negative paradigm), ZntA (a P-type ATPase) serves as the major zinc efflux pump

    • B. subtilis utilizes both CzcD (CDF antiporter) and CadA (P-type ATPase) for zinc efflux

    • This difference suggests that Gram-positive bacteria may require multiple, potentially redundant systems to achieve effective metal detoxification in the absence of an outer membrane barrier

  • Energetic considerations:

    • P-type ATPases directly couple ATP hydrolysis to metal transport

    • CDF antiporters typically utilize the proton motive force or other ion gradients

    • The prevalence of different transporter types may reflect adaptations to the energetic economy of each bacterial type

These comparisons highlight how fundamental cellular architecture shapes the evolution of metal resistance strategies and provides insights for developing targeted antimicrobial approaches based on these differences.

How can site-directed mutagenesis of B. subtilis CzcD contribute to understanding metal selectivity mechanisms?

Site-directed mutagenesis of B. subtilis CzcD provides powerful insights into the molecular determinants of metal selectivity through systematic modification of key structural elements:

  • Metal-binding site mutations:

    • Substituting conserved coordinating residues (e.g., aspartate, glutamate, histidine) with alanine or conservative replacements

    • Analyzing shifts in relative transport rates for different metals after mutation

    • Such experiments could reveal whether distinct residues coordinate different metals or if the same binding site accommodates multiple substrates with varying affinities

  • Transmembrane domain modifications:

    • Mutations in conserved transmembrane motifs often dramatically affect transporter function

    • For example, mutations analogous to E179A/D or R182A/K in related transporters completely abolish transport activity, while conservative substitutions (E179D, R182K) preserve function but may alter substrate preferences or pH profiles

    • These experiments can identify residues that form the transport pathway versus those involved in substrate recognition

  • Interdomain communication analysis:

    • Mutations at the interface between membrane and cytoplasmic domains can reveal how substrate binding induces conformational changes necessary for transport

    • Double mutant cycles can identify functionally coupled residues involved in the transport mechanism

  • Chimeric constructs:

    • Creating fusion proteins between CzcD and related transporters with different substrate preferences

    • Determining which domains confer specificity for particular metal ions

Empirical validation of transport activity following mutagenesis, using methods like everted membrane vesicles and growth complementation assays in metal-sensitive strains, provides quantitative assessment of how specific residues contribute to metal selectivity mechanisms .

What are the implications of CzcD research for developing antimicrobial strategies targeting metal homeostasis?

Research on B. subtilis CzcD and related metal transporters has significant implications for developing novel antimicrobial strategies that target bacterial metal homeostasis:

  • Selective inhibition approach:

    • Understanding the structural and functional differences between bacterial CzcD and human metal transporters enables the design of inhibitors that specifically target bacterial systems

    • Compounds that block CzcD function could potentiate zinc toxicity in bacteria while sparing human cells

    • This strategy is supported by observations that bacteria lacking functional metal efflux systems show increased sensitivity to metals and antibiotics

  • Metal-antibiotic synergy:

    • Research has shown that bacterial co-treatment with ciprofloxacin and non-toxic amounts of zinc compounds increased antibiotic activity toward both B. subtilis and E. coli

    • This synergistic effect could lead to combination therapies using lower antibiotic doses, reducing side effects and selection for resistance

  • Pathogen-specific targeting:

    • Species-specific differences in metal transport systems, such as the unique ZccE transporter in Streptococcus mutans, provide targets for highly selective antimicrobials

    • For example, zinc-based therapies specifically targeting S. mutans could potentially treat dental caries without disrupting beneficial oral flora

  • Biofilm prevention:

    • Metal homeostasis systems like CzcD are crucial for bacterial biofilm formation

    • Targeted inhibition of these systems could prevent biofilm development, addressing a major challenge in treating chronic bacterial infections

These approaches represent promising directions for addressing antibiotic resistance by exploiting the essential nature of metal homeostasis in bacterial physiology.

What are the current challenges in expressing and purifying functional recombinant B. subtilis CzcD for structural studies?

Expressing and purifying functional recombinant B. subtilis CzcD for structural studies presents several significant challenges that researchers must address:

  • Membrane protein expression obstacles:

    • As an integral membrane protein, CzcD often expresses at lower levels than soluble proteins

    • Overexpression frequently leads to misfolding, aggregation, and inclusion body formation

    • The hydrophobic nature of transmembrane domains complicates proper insertion into expression host membranes

  • Purification challenges:

    • Extraction from membranes requires detergents that must maintain protein structure and function

    • Finding the optimal detergent or lipid nanodisc composition that preserves native conformation is often empirical

    • Maintaining stability during concentration steps needed for structural studies can cause aggregation

  • Functional verification complexities:

    • Confirming that purified protein retains transport activity requires reconstitution into proteoliposomes

    • Transport assays with reconstituted protein are technically challenging and may require radioisotopes or specialized fluorescence assays

    • Distinguishing specific transport from non-specific leakage across proteoliposome membranes requires careful controls

  • Structural study limitations:

    • Crystallization of membrane proteins for X-ray crystallography is notoriously difficult

    • Cryo-EM studies may require larger protein complexes or antibody fragments to increase particle size

    • NMR studies are complicated by the large size of protein-detergent complexes

Successful approaches often include fusion partners to enhance expression and solubility, careful detergent screening, and the use of stabilizing mutations identified through directed evolution or alanine scanning mutagenesis.

How might systems biology approaches enhance our understanding of metal homeostasis networks involving CzcD?

Systems biology approaches offer powerful frameworks for comprehensively understanding the complex metal homeostasis networks involving CzcD in B. subtilis:

  • Multi-omics integration:

    • Combining transcriptomics, proteomics, and metabolomics data can reveal how CzcD functions within the broader metal homeostasis network

    • Proteomic analyses have already identified significant shifts in protein expression profiles related to metal ion export, oxidative stress response, redox homeostasis, information processing, metabolism, and cell envelope dynamics when B. subtilis is exposed to metal stress

    • Expanding these analyses to include temporal dynamics and dose-dependent responses would provide deeper insights into regulatory networks

  • Network modeling:

    • Mathematical modeling of ion transport kinetics, incorporating multiple transporters (CzcD, CadA) and their regulators

    • Simulation of metal homeostasis under varying environmental conditions to predict system behavior

    • Identification of key control points that could be targets for antimicrobial development

  • Synthetic biology applications:

    • Engineering bacterial strains with modified CzcD expression or activity to test model predictions

    • Creating synthetic circuits that report on intracellular metal concentrations in real-time

    • Developing bacteria with enhanced metal resistance for bioremediation applications

  • Comparative genomics extension:

    • Analyzing CzcD homologs across diverse bacterial species to understand evolutionary adaptations to different metal environments

    • Identifying conserved and variable elements of metal homeostasis networks

These systems-level approaches would move beyond studying CzcD in isolation to understanding its dynamic interactions within the cellular metal management network, potentially revealing emergent properties not apparent from reductionist studies.

What role might CzcD play in B. subtilis adaptation to environmental metal stress in natural habitats?

In natural habitats, CzcD likely plays multifaceted roles in B. subtilis adaptation to environmental metal stress, extending beyond simple detoxification:

  • Ecological niche occupation:

    • CzcD-mediated metal resistance may enable B. subtilis to colonize environments with elevated metal concentrations that exclude less resistant competitors

    • Soil environments, where B. subtilis naturally occurs, can have heterogeneous metal distributions due to both geological factors and anthropogenic pollution

  • Stress response coordination:

    • Proteomic analyses reveal that metal stress triggers comprehensive cellular responses beyond direct metal export

    • CzcD functions within a broader adaptation network including oxidative stress defenses, altered metabolism, and cell envelope modifications

    • This integrated response suggests CzcD is part of a coordinated strategy for environmental adaptation

  • Sporulation interaction:

    • Metal stress and homeostasis systems interact with sporulation pathways in B. subtilis

    • Similar to how Na+/H+ antiporters such as ShaA impact sporulation , CzcD may influence sporulation decisions under metal stress

    • This connection could provide a mechanism for population-level bet-hedging strategies in fluctuating environments

  • Biofilm development:

    • CzcD and metal homeostasis affect biofilm formation capabilities

    • In natural soil habitats, biofilm formation is a crucial adaptation that may be regulated partly through metal sensing and transport systems

  • Interspecies competition:

    • Metal sequestration and tolerance are important factors in microbial community dynamics

    • The efficiency of CzcD in managing metal stress may determine competitive outcomes in polymicrobial habitats

Understanding these ecological roles requires field studies correlating CzcD expression levels with environmental metal concentrations and community composition in natural B. subtilis habitats.

What novel experimental techniques could advance structural and functional characterization of CzcD?

Several cutting-edge experimental techniques hold promise for advancing the structural and functional characterization of B. subtilis CzcD:

  • Advanced structural biology methods:

    • Single-particle cryo-electron microscopy (cryo-EM) to resolve transporter structure in different conformational states

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map conformational changes during transport cycle

    • Solid-state NMR in native-like lipid environments to analyze dynamics and substrate interactions

    • Microcrystal electron diffraction (MicroED) for structure determination using nanoscale crystals

  • Real-time transport measurements:

    • Development of genetically encoded fluorescent metal sensors for real-time tracking of metal transport in living cells

    • Patch-clamp electrophysiology of reconstituted CzcD to measure transport rates with millisecond resolution

    • Single-molecule fluorescence resonance energy transfer (FRET) to observe conformational changes during transport cycle

  • In situ characterization:

    • Correlative light and electron microscopy (CLEM) to visualize CzcD localization and function in native cellular contexts

    • Proximity labeling techniques (BioID, APEX) to map the CzcD interactome in living cells

    • Super-resolution microscopy to analyze CzcD distribution and clustering in bacterial membranes

  • High-throughput functional analysis:

    • Deep mutational scanning to comprehensively assess the impact of all possible amino acid substitutions on CzcD function

    • Microfluidic platforms for rapid assessment of metal transport kinetics under varied conditions

    • CRISPR interference screens to identify genetic interactions with CzcD

  • Computational approaches:

    • Molecular dynamics simulations of CzcD in membrane environments to model transport mechanisms

    • Machine learning algorithms to predict substrate specificity determinants based on sequence information

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.