Recombinant Bacillus subtilis CDP-diacylglycerol--serine O-phosphatidyltransferase (pssA)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant PssA

Recombinant PssA is produced by expressing the pssA gene from B. subtilis in heterologous systems like E. coli or yeast, often fused with a His-tag for purification . Key features include:

PropertySpecification
Molecular FunctionCatalyzes the reaction: CDP-diacylglycerol + L-serine → CMP + phosphatidylserine .
Gene ID938427 (B. subtilis subsp. subtilis str. 168)
UniProt IDP39823
TagN-terminal His-tag
Purity>80% (SDS-PAGE) ; >90% in some formulations
Storage-20°C to -80°C in PBS or Tris buffer

Functional Characterization

  • Substrate Specificity: Prefers CDP-diacylglycerol over archaeal analogs (e.g., CDP-archaeol), distinguishing it from homologs in Methanobacteria .

  • Overexpression Effects: In E. coli, recombinant PssA elevates phosphatidylethanolamine (PE) content to 90% of total phospholipids, unlike endogenous E. coli PssA .

Industrial Applications

  • Enhanced Protein Secretion: B. subtilis strains with pssA knockouts show up to 30% increased secretion of heterologous α-amylases due to altered membrane charge and permeability .

  • Membrane Engineering: Co-deletion of pssA and clsA (cardiolipin synthase) further optimizes secretion yields, making it a preferred host for industrial enzyme production .

Comparative Analysis of Recombinant PssA Variants

ParameterB. subtilis PssA Mycobacterium bovis PssA
Host SystemE. coli/YeastE. coli
Protein Length177 amino acids286 amino acids
FormLiquid/lyophilized powderLyophilized powder
Endotoxin Levels<1.0 EU/μgNot specified
Key ApplicationsMembrane biology studiesArchaeal lipid metabolism research

Key Industrial and Research Uses

  • Membrane Charge Modulation: Regulates teichoic acid alanylation and PE synthesis, reducing net negative charge to resist cationic antimicrobial peptides .

  • Biochemical Tool: Used to study phosphatidylserine decarboxylation pathways in Gram-positive bacteria .

  • Custom Production: Available as a custom-order protein with lead times of 5–9 weeks for tailored research needs .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
pssA; pss; BSU02270; CDP-diacylglycerol--serine O-phosphatidyltransferase; Phosphatidylserine synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
pssA
Target Protein Sequence
MNYIPCMITIGNFICGLLAIHSLLYHNIHSAVLFIFTGMFLDFFDGMAARKLNAVSDMGR ELDSFADLVTFGVAPSMLAYSVALYTLPFIGILCALTYSICGMLRLSKFNIEQSKLPTFI GMPIPFAGMCLVILSFTYNPILLAIGTCGLSYLMVSKIKFPHFKKHAAENLESGRWN
Uniprot No.

Target Background

Database Links
Protein Families
CDP-alcohol phosphatidyltransferase class-I family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of B. subtilis PssA in phospholipid biosynthesis?

PssA (CDP-diacylglycerol--serine O-phosphatidyltransferase) is a key enzyme in the biosynthetic pathway of phospholipids in Bacillus subtilis. It catalyzes the formation of phosphatidylserine (PS) from CDP-diacylglycerol and L-serine. This enzyme belongs to the CDP-alcohol phosphatidyltransferase family, which includes enzymes that catalyze the replacement of the cytidine monophosphate (CMP) entity of CDP-archaeol or CDP-diacylglycerol with a polar head group . The B. subtilis PssA belongs to subclass II of phosphatidylserine synthases, which are widespread among Gram-positive bacteria, while the E. coli version belongs to subclass I, typically found in Gram-negative bacteria .

How does B. subtilis PssA differ from E. coli phosphatidylserine synthase in terms of substrate specificity?

Studies using cell-free extracts have demonstrated significant differences in substrate specificity between these enzymes. While both B. subtilis PssA and Methanothermobacter thermautotrophicus PssA exhibit broad substrate specificity and can accept lipid derivatives from both archaea and bacteria, the E. coli phosphatidylserine synthase is highly specific for bacterial lipid derivatives only . This biochemical distinction is important when designing heterologous expression systems or when studying the evolutionary relationships between these enzymes.

What is the current understanding of PssA's membrane topology?

Recent research has significantly revised our understanding of PssA's membrane topology. While earlier predictions using multiple algorithms suggested bi- or polytopic transmembrane topology, contemporary biochemical analysis using PssA-PhoALacZ fusions, supported by homology modeling, structural modeling, and residue conservation analyses, has established a new model. PssA is now recognized as a monotopic phosphatidylglycerol transferase (PGT) with a reentrant membrane helix rather than a completely membrane-spanning helix (TMH) . This structural characteristic has important implications for understanding how the enzyme interacts with its substrates at the membrane interface.

What methods are effective for detecting the subcellular localization of PssA?

Determining the subcellular localization of PssA requires complementary approaches:

  • Cell fractionation followed by Western blotting: This approach has been successfully applied to both heterologous (E. coli) and homologous (Rhizobium) systems. The procedure involves:

    • Separation of the non-inclusion fraction

    • Further fractionation to separate cytoplasmic and membrane proteins

    • Western blotting with anti-His₆ antibodies (when using His-tagged PssA)

This method has clearly demonstrated that PssA is located in the integral membrane protein fraction in both E. coli and Rhizobium .

  • Reporter fusion systems: The PhoA-LacZα dual reporter system has proven valuable for topology studies of membrane proteins including PssA. This approach involves:

    • Construction of fusion proteins with reporter sequences

    • Measurement of alkaline phosphatase and β-galactosidase activities

    • Calculation of normalized activity ratios (NAR) to interpret results

These complementary methods provide robust evidence for PssA's membrane association and topology.

What expression systems are most suitable for producing recombinant B. subtilis PssA?

Expression of recombinant B. subtilis PssA has been successfully achieved in E. coli BL21(DE3) using the pET30 vector system . Key considerations for expression include:

  • Purification conditions: Recombinant His₆-PssA can be efficiently recovered from membranes only in the presence of detergents, highlighting its strong association with the membrane .

  • Fusion tag selection: Histidine tags have been successfully used for detection and purification of recombinant PssA.

  • Subcellular targeting: When expressing PssA for functional studies, proper membrane targeting is essential as it is an integral membrane protein.

For homologous expression, medium copy vectors such as pBBR1MCS-2 have been used successfully to complement deletion mutants .

How can researchers effectively model the structure of PssA given its membrane association?

Structural modeling of PssA presents unique challenges due to its membrane association. A comprehensive approach includes:

  • Homology modeling: Using related proteins with known structures as templates.

  • Topology prediction algorithms: Multiple algorithms should be employed, with their results compared critically against experimental data.

  • Conservation analysis: Identifying conserved residues can provide insights into functional domains and structural elements.

  • Experimental validation: Biochemical analyses using PssA-PhoALacZ fusions can confirm the in silico predictions.

Recent studies have employed this multi-faceted approach to revise the topology model of PssA, revealing it as a monotopic membrane protein with a reentrant helix rather than a transmembrane spanning domain .

What are the advantages of using dual reporter systems for membrane topology analysis of PssA?

The dual reporter system combining PhoA and LacZα provides significant advantages for topology studies of membrane proteins like PssA:

  • Simultaneous detection: Both cytoplasmic and periplasmic/extracellular localization can be detected in a single construct.

  • Internal validation: The opposing activities of the two reporters (PhoA is active in the periplasm, LacZ in the cytoplasm) provide a built-in control.

  • Quantitative analysis: The normalized activity ratio (NAR) provides a quantitative measure that helps interpret results from fusion points located in transmembrane regions.

The system has been validated using proteins with known topology, such as PssT fragments, demonstrating its reliability . For PssA topology studies, three fusion constructs (A85, A180, and A263) have provided valuable insights into its membrane association.

Fusion ConstructFusion Site LocationPhoA ActivityLacZ ActivityNARInterpretation
A85Middle of predicted TM helixVariableVariableMixedInterface region
A180Between α-helices 3 and 4LowHighCytoplasmicCytoplasmic domain
A263Full-length proteinLowHighCytoplasmicC-terminus in cytoplasm

What genetic approaches are most effective for creating and analyzing pssA deletion mutants?

Creating precise pssA deletion mutants requires strategic approaches:

  • Cre-loxP-based gene replacement system: This method has been successfully employed for precise pssA deletion, avoiding polar effects on adjacent genes .

  • Complementation strategies: Medium-copy plasmids carrying the pssA gene with appropriate tags (such as histidine tags) can be used to confirm mutant phenotypes are specifically due to pssA deletion.

For comprehensive analysis of pssA mutants, a multi-faceted approach is recommended:

  • Phenotypic characterization: Examining growth rates, colony morphology, stress responses, and specific biochemical traits.

  • Transcriptomic analysis: RNA-seq based analysis can reveal the widespread effects of pssA deletion on the bacterial transcriptome, providing insights into its regulatory roles beyond direct enzymatic function .

  • Biochemical verification: Confirming the absence of specific phospholipids or altered membrane composition.

What transcriptional changes occur in response to pssA deletion and how can they be interpreted?

RNA-seq analysis of pssA deletion mutants has revealed significant transcriptional changes, particularly in genes related to stress response and energy metabolism:

  • Upregulation of stress response genes: Genes encoding proteins of the aldehyde dehydrogenase family, which mitigate various stresses in bacteria .

  • Energy metabolism adaptations: Increased expression of phosphoenolpyruvate carboxykinase (involved in gluconeogenesis) and cytochrome bd ubiquinol oxidase subunits .

  • Signal transduction changes: Altered expression in pathways related to two-component system (TCS)-based signal transduction mechanisms .

These transcriptional changes can be interpreted as compensatory mechanisms in response to the stress induced by altered membrane composition in the absence of PssA. The upregulation of cytochromes may specifically represent a response to oxidative stress, as mutant cells deficient in exopolysaccharides lack a protective surface layer .

How does B. subtilis PssA compare with homologous enzymes from other bacterial species?

B. subtilis PssA belongs to subclass II of phosphatidylserine synthases, which are widespread among Gram-positive bacteria. Comparative analysis reveals:

  • Substrate specificity differences: Unlike E. coli PS synthase (subclass I), which is specific for bacterial lipid derivatives, B. subtilis PssA shows broader substrate specificity similar to archaeal homologs from Methanothermobacter thermautotrophicus .

  • Evolutionary relationships: The CDP-alcohol phosphatidyltransferase family, to which PssA belongs, is found across all three domains of life, suggesting an ancient evolutionary origin .

  • Structural conservation: Despite sequence divergence, key structural elements are preserved, particularly in the catalytic domains.

This comparative perspective is valuable for understanding the evolution of phospholipid biosynthesis pathways and for designing experiments that leverage natural variations in enzyme properties.

What roles does PssA play in cell stress responses and how can this be experimentally demonstrated?

PssA deletion studies have indicated its importance in stress response pathways:

  • Oxidative stress management: Deletion of pssA leads to upregulation of genes involved in oxidative stress tolerance, including cytochrome bd ubiquinol oxidase subunits .

  • General stress response: Upregulation of aldehyde dehydrogenases, which contribute significantly to stress management in bacteria .

To experimentally demonstrate these connections, researchers can:

  • Conduct stress challenge experiments: Compare wild-type and pssA mutant strains under various stress conditions (oxidative, osmotic, temperature).

  • Measure stress markers: Quantify reactive oxygen species, stress proteins, or enzymatic activities related to stress management.

  • Perform reporter gene assays: Use stress-responsive promoters fused to reporter genes to visualize stress responses in real-time.

  • Conduct epistasis experiments: Create double mutants affecting both pssA and stress response genes to elucidate pathway relationships.

How can recombinant PssA be effectively purified while maintaining enzymatic activity?

Purification of functional recombinant PssA presents unique challenges due to its membrane association. An effective protocol includes:

  • Expression optimization:

    • Use E. coli BL21(DE3) with pET30-pssA plasmid

    • Optimize induction conditions (temperature, IPTG concentration, duration)

  • Membrane extraction:

    • Careful cell lysis that preserves membrane integrity

    • Separation of non-inclusion fractions

    • Isolation of membrane fractions

  • Solubilization:

    • Use of appropriate detergents, as PssA can only be efficiently recovered from membranes in their presence

    • Optimization of detergent type and concentration to maintain enzyme activity

  • Affinity purification:

    • Utilizing histidine tags for affinity chromatography

    • Careful selection of elution conditions that do not disrupt activity

  • Activity preservation:

    • Stabilizing buffer components

    • Storage conditions optimization

Each step requires careful optimization to balance protein yield with preservation of enzymatic activity.

What in vitro assay systems can be used to determine the enzymatic activity and substrate specificity of PssA?

Several complementary assay systems can be employed to characterize PssA activity:

  • Radiometric assays:

    • Using radiolabeled substrates (e.g., [14C]-serine)

    • Measuring incorporation into phospholipid products

    • Separation of products by thin-layer chromatography

  • Coupled enzyme assays:

    • Monitoring CMP release using coupling enzymes

    • Spectrophotometric detection of NADH oxidation

  • Mass spectrometry-based assays:

    • Direct detection of reaction products

    • Quantification of substrate consumption and product formation

    • Identification of alternative substrates

  • Fluorescence-based assays:

    • Using fluorescently labeled substrates

    • Real-time monitoring of enzyme kinetics

These assays can be used to determine:

  • Catalytic constants (Km, Vmax)

  • Substrate preferences

  • Cofactor requirements

  • Inhibitor profiles

What are common challenges in expressing recombinant B. subtilis PssA and how can they be addressed?

Expression of recombinant PssA presents several technical challenges:

  • Toxicity issues:

    • Problem: Overexpression of membrane proteins can disrupt host cell membranes

    • Solution: Use tightly controlled expression systems; lower induction temperatures; optimize inducer concentration

  • Inclusion body formation:

    • Problem: Misfolded PssA may aggregate in inclusion bodies

    • Solution: Lower expression temperature (16-20°C); use solubility-enhancing fusion tags; optimize induction conditions

  • Improper membrane integration:

    • Problem: Recombinant PssA may not properly integrate into host membranes

    • Solution: Use appropriate signal sequences; select compatible host strains; modify growth media composition

  • Low protein yield:

    • Problem: Membrane proteins often express at lower levels than soluble proteins

    • Solution: Scale up culture volumes; optimize codon usage; use specialized expression strains

  • Activity loss during purification:

    • Problem: Detergents necessary for purification may inactivate the enzyme

    • Solution: Screen multiple detergent types and concentrations; use mild extraction conditions; include stabilizing agents

How can researchers confirm the correct folding and membrane integration of recombinant PssA?

Verifying proper folding and membrane integration of recombinant PssA requires multiple approaches:

  • Activity assays: Functional activity is the ultimate confirmation of proper folding.

  • Membrane fractionation: Confirm localization to the membrane fraction through careful cell fractionation followed by Western blotting .

  • Circular dichroism (CD) spectroscopy: Assess secondary structure content to confirm proper folding.

  • Protease accessibility assays: Determine exposed regions of the protein in membrane preparations.

  • Fluorescence-based techniques:

    • Intrinsic tryptophan fluorescence to assess tertiary structure

    • Fluorescent dye binding to hydrophobic regions

  • Thermal stability assays: Well-folded proteins typically show cooperative unfolding transitions.

By combining these approaches, researchers can confidently assess whether their recombinant PssA is properly folded and integrated into membranes.

How can PssA be leveraged in synthetic biology applications for membrane engineering?

PssA offers several opportunities for membrane engineering in synthetic biology:

  • Phospholipid composition modification:

    • Altering phosphatidylserine content in membranes

    • Creating novel phospholipid profiles by expressing PssA variants with altered specificity

  • Membrane protein production platforms:

    • Optimizing phospholipid environments for recombinant membrane protein expression

    • Engineering host strains with modified PssA expression for enhanced membrane protein yields

  • Biosensor development:

    • Creating systems that respond to changes in membrane composition

    • Developing reporters linked to PssA activity

  • Interspecies membrane engineering:

    • Exploiting the broader substrate specificity of B. subtilis PssA (compared to E. coli) to create hybrid membranes with archaeal-like properties

    • Engineering bacterial cells with modified membrane properties for biotechnological applications

The versatility of PssA makes it a valuable tool for synthetic biologists seeking to engineer cellular membranes with specific properties.

What are the most promising directions for future research on B. subtilis PssA?

Future research on B. subtilis PssA could profitably explore:

  • Detailed structural studies:

    • Obtaining crystal structures of PssA alone and in complex with substrates

    • Investigating the dynamics of the reentrant membrane helix

    • Understanding substrate binding and catalytic mechanisms at atomic resolution

  • Systems biology approaches:

    • Further exploration of the transcriptional networks influenced by PssA

    • Integration of pssA function with other cellular processes through multi-omics approaches

    • Mathematical modeling of phospholipid homeostasis

  • Biotechnological applications:

    • Development of PssA variants with novel substrate specificities

    • Creation of bacteria with engineered membrane compositions for industrial applications

    • Utilization in lipidomic toolsets for membrane engineering

  • Evolutionary studies:

    • Comparative analysis of PssA across diverse bacterial species

    • Investigation of horizontal gene transfer events involving pssA

    • Understanding the co-evolution of membrane biosynthesis pathways

These research directions will contribute to both fundamental understanding of bacterial physiology and practical applications in biotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.