Recombinant Bacillus subtilis Cell division topological determinant MinJ (minJ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. You can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
minJ; swrAB; yvjD; BSU35220; Cell division topological determinant MinJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-397
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
minJ
Target Protein Sequence
MSVQWGIELLKSAGLFFLHPLFWFFIIITLAFGYVRIKRERKTFHTRIADIYDDLKFTYT KGLIPGLLLSVILGGLGISIPLGLLAIIAVITAAAAFTLRANWMSAAYIVSVSMLIGFGL QIYQAEPFLERFPQGFAVVWPAVAVFLGLLIITEGAVAYRSAHVRTSPALVVSSRGLPIG QQLANRVWLLPLFLLVPGNGLESHLSWWPVFTVPGGSFHFLWIPYFVGFGQRVQGSLPET SIRITAKRVCILGLAVAVLGAASLLWTPLAGAAVCTALLGRIFLSIKQRVNDNAAPFYFS KRDQGLMVLGIIPNTPAEDLELKIGEIITKVNGIPVKNVSDFYEALQHNRAYVKLEIIGL NGEIRFDQRASYEGEHHELGILFVKDDREDEAVASGS
Uniprot No.

Target Background

Function
The primary function of the Min system is to facilitate the disassembly of the cytokinetic ring following cell division, ensuring that division occurs only once per cell cycle. MinJ serves as a bridge between DivIVA and MinD. It may modulate the activity and localization of MinD and MinC through direct interaction with MinD.
Gene References Into Functions
  1. Mutations in MinJ lead to defects in homologous recombination, swarming motility, and cell division. MinJ localizes to cell poles in a DivIVA-dependent manner. PMID: 18976281
  2. MinJ is a topological determinant of medial FtsZ positioning in cell division that acts as an intermediary between DivIVA and MinD PMID: 18976281
Database Links
Protein Families
MinJ family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Note=Localization depends on DivIVA and on the state of the cell cycle. Present at both cell poles in non-dividing cells. As cells prepare to divide, moves from poles to mid-cell. Then, after division is completed, stays associated with new poles, but also moves back to old poles.

Q&A

What is MinJ and what is its role in Bacillus subtilis cell division?

MinJ (YvjD) is a topological determinant of cell division in Bacillus subtilis that acts as a critical intermediary between DivIVA and MinD proteins. It functions as a bridge in the Min system, which regulates the positioning of the cell division septum. Specifically, MinJ restricts MinD activity by localizing it to the cell poles through direct protein-protein interactions . This localization pattern ensures that FtsZ ring formation and subsequent cell division occur properly at midcell rather than at the poles.

Unlike the oscillatory Min system in E. coli, B. subtilis employs a stationary gradient system where MinJ plays a central role in maintaining the proper spatial organization of division inhibitor proteins. When minJ is deleted or mutated, cells exhibit pleiotropic defects in homologous recombination, swarming motility, and cell division due to unrestricted MinD activity .

How does the Min system of B. subtilis differ from that of E. coli?

The Min systems in B. subtilis and E. coli represent two distinct evolutionary approaches to the same problem of positioning the division site at midcell:

  • Component differences: B. subtilis lacks MinE (essential for oscillation in E. coli) but instead utilizes DivIVA and MinJ proteins not found in E. coli .

  • Dynamic behavior: In E. coli, MinD oscillates from pole to pole, while in B. subtilis, Min proteins form a stationary bipolar gradient decreasing toward midcell . This gradient restricts FtsZ ring assembly to the midplane.

  • Molecular mechanism: In B. subtilis, DivIVA provides the spatial cue by targeting negatively curved membrane regions, with MinJ then acting as the connector between DivIVA and MinD .

  • Functional differences: While both systems prevent polar division during vegetative growth, the B. subtilis Min system also plays a distinct role during sporulation, a differentiation process beginning with asymmetrical cell division .

Interestingly, when the E. coli Min proteins are introduced into B. subtilis, they can reproduce the oscillatory behavior seen in E. coli, suggesting fundamental compatibility in the molecular mechanisms despite the different native systems .

What is the stoichiometry of MinJ relative to other Min proteins in B. subtilis?

MinJ exists at significantly lower abundance than other components of the Min system in B. subtilis. Based on quantitative protein analyses, the relative numbers of Min proteins during mid-exponential growth phase are:

ProteinMolecules per cellPercentage relative to MinD
MinD3544100%
DivIVA169047.7%
MinJ57616.3%

These numbers were determined through mass spectrometry and in-gel fluorescence techniques . The lower abundance of MinJ (only 16% of MinD abundance) suggests that MinJ may function as a limiting factor in the Min system, potentially serving as a regulatory node through controlled expression or activity.

What is the localization pattern of MinJ in B. subtilis cells?

MinJ in B. subtilis primarily localizes to two distinct cellular regions:

  • Cell poles: During vegetative growth, MinJ concentrates at the cell poles in a DivIVA-dependent manner. This polar localization is crucial for restricting MinD (and consequently MinC) to the poles, thereby preventing division at these sites .

  • Division septa: As cell division progresses, MinJ dynamically relocates to the developing septum, often appearing as clusters at active division sites . This localization is important for proper regulation of divisome assembly and function.

The localization of MinJ is not static but exists in a dynamic steady state, with continual exchange between membrane-bound and cytoplasmic pools. Fluorescence recovery after photobleaching (FRAP) experiments reveal that MinJ has a significant mobile fraction, although its dynamics are considerably slower than MinD .

How does MinJ's role change during different growth phases and cellular processes?

MinJ exhibits different behaviors and functions depending on the cellular growth phase and developmental stage:

  • Vegetative growth: During normal growth, MinJ serves primarily to position the division machinery at midcell by restricting MinD activity to the poles .

  • Cell division: As division initiates, MinJ dynamically relocates to the division septum, suggesting a role in coordinating the completion of cell division .

  • Sporulation: During sporulation, the asymmetric cell division process requires a distinct regulatory mechanism. The presence of a non-oscillating Min system in B. subtilis appears to be evolutionarily important for efficient asymmetrical septum formation . Evidence suggests that introducing an oscillatory Min system (like that of E. coli) into B. subtilis inhibits sporulation, indicating that MinJ's static gradient-forming properties are critical for proper sporulation .

This multifunctional capability reflects MinJ's importance as an adaptable component of the division machinery that responds to changing cellular needs.

What are the most effective methods for studying MinJ dynamics in living cells?

Several methods have proven effective for studying MinJ dynamics in living B. subtilis cells:

  • Fluorescent protein fusions with native expression levels: Creating fluorescent fusions via allelic exchange rather than using overexpression constructs is crucial for observing authentic MinJ dynamics . The table below shows key fluorescent constructs and their effects on cell physiology:

StrainDescriptionMean growth rate constant (μ) ± SDMean cell length (μm) ± SD% Minicells
JB38MinJ-Dendra20.51 ± 0.0063.44 ± 1.060
BHF007MinJ-msfGFP0.57 ± 0.0133.38 ± 0.760.3
JB40MinJ-mNeonGreen0.57 ± 0.0023.16 ± 0.670
  • Fluorescence Recovery After Photobleaching (FRAP): This technique has been used successfully to determine protein dynamics and calculate diffusion coefficients of MinJ and other Min proteins . MinJ exhibits slower dynamics compared to MinD but is still in a dynamic steady state.

  • Single Molecule Localization Microscopy (SMLM): This approach provides nanoscale spatial distribution information for MinJ, revealing its organization in clusters and detailed interaction patterns with other Min components .

  • Time-lapse microscopy: This method enables tracking of MinJ relocalization during cell cycle progression, particularly during the transition from polar to septal localization .

What phenotypes are observed in minJ deletion mutants?

Deletion of minJ results in several distinct phenotypes that reveal its importance in multiple cellular processes:

  • Division defects: ΔminJ mutants exhibit aberrant cell division, with divisions occurring at incorrect locations including the cell poles, resulting in the formation of minicells .

  • Cell elongation: The absence of MinJ leads to significant cell elongation. While wild-type B. subtilis cells typically measure around 3.11 μm in length, ΔminJ mutants have been measured at approximately 6.65 μm (more than double the normal length) .

  • Minicell formation: About 13.8% of cells in a ΔminJ population form minicells, compared to only 0.3% in wild-type populations .

  • Pleiotropic effects: Beyond division defects, ΔminJ mutants show impaired homologous recombination and swarming motility, indicating MinJ's involvement in multiple cellular processes .

  • Growth rate reduction: ΔminJ strains show slightly reduced growth rates compared to wild-type strains (μ = 0.51 ± 0.049 for ΔminJ vs. μ = 0.53 ± 0.004 for wild-type) .

These phenotypes highlight MinJ's role as a multifunctional protein affecting not only division site selection but also other fundamental cellular processes.

How does MinJ contribute to the mathematical modeling of the B. subtilis Min system?

Mathematical modeling of the B. subtilis Min system incorporating MinJ has provided significant insights into its dynamics:

  • Reaction-diffusion modeling: Recent models treat the Min system as a reaction-diffusion system in realistic 3D cell geometry, with MinD dynamics influenced by space-dependent recruitment and detachment processes that implicitly incorporate the effects of DivIVA and MinJ .

  • Diffusion coefficients: Experimentally determined diffusion coefficients (between 0.057 μm²/s and 0.0034 μm²/s) have been integrated into these models, helping to explain the membrane-cytosol exchange dynamics of Min proteins .

  • Dynamic equilibrium state: Computational analyses suggest that localization of MinD to the poles or division site corresponds to a dynamic equilibrium state rather than a static configuration . This aligns with experimental observations of continuous protein exchange between membrane and cytosol.

  • Geometric effects: Models suggest that the cell's geometry alone could explain septum localization of MinD once DivIVA is present, with MinJ serving as the connector between these components .

The mathematical model can be extended to include explicit dynamics of DivIVA and MinJ, potentially helping to identify the essential components of Min dynamics in B. subtilis, similar to successful approaches used for the E. coli Min system .

What is the relationship between MinJ and membrane curvature sensing?

The relationship between MinJ and membrane curvature sensing appears to be indirect but significant:

  • DivIVA as primary curvature sensor: DivIVA, which recruits MinJ, has been shown to target and localize to negatively curved membrane regions . This curvature sensing property is crucial for the initial spatial organization of the Min system.

  • MinJ as a connector: MinJ does not directly sense curvature but rather relies on DivIVA's targeting to curved membranes. MinJ then serves as the connector that recruits MinD to these locations .

  • Geometric cue facilitation: The model proposed based on experimental data suggests that the Min complex is in a dynamic steady state that can relocalize from the cell pole to the septum, facilitated by a geometric cue—namely, the invagination of the membrane at the septum .

  • Curvature-driven protein gradient: The combination of DivIVA's curvature sensing and MinJ's linking function creates a system where protein gradients are established based on membrane geometry, enabling the Min system to respond dynamically to changes in cell shape during growth and division .

This sophisticated interplay between protein interactions and membrane geometry allows the B. subtilis Min system to function effectively without the oscillatory behavior seen in E. coli.

How do the dynamics of MinJ compare with other components of the Min system?

The dynamics of MinJ differ significantly from other Min components, reflecting its unique role in the system:

  • Recovery times: FRAP experiments reveal that MinD has the shortest recovery time of the three investigated proteins (MinD, MinJ, and DivIVA). MinJ and DivIVA both show considerably slower dynamics compared to MinD, but are similar to each other .

  • Mobile fractions: MinD has the highest mobile fraction with almost 80% of the protein participating in recovery after photobleaching. MinJ shows an intermediate level of mobility .

  • Comparative diffusion coefficients:

    • MinD: Highest diffusion coefficient

    • MinJ: Intermediate diffusion coefficient

    • DivIVA: Lowest diffusion coefficient, reflecting its role as a relatively stable structural component

  • Patterns of movement: Unlike the pole-to-pole oscillation observed in E. coli's MinD, B. subtilis MinJ shows a more subtle dynamic pattern involving exchange between membrane-bound and cytoplasmic pools, as well as relocalization during cell division .

These differential dynamics create a system where MinD's relatively fast exchange is guided and constrained by the slower dynamics of MinJ and DivIVA, establishing a stable but adaptable protein localization pattern.

How conserved is MinJ among different bacterial species?

MinJ shows a specific pattern of conservation that provides insights into the evolution of cell division mechanisms:

  • Taxonomic distribution: MinJ is primarily conserved in low G+C Gram-positive bacteria, suggesting it evolved as a specialized component of cell division in this bacterial lineage .

  • Functional conservation: In species where MinJ is present, it consistently serves as an intermediary between DivIVA and MinD components of the Min system, indicating strong selective pressure to maintain this functional role .

  • Structural variation: While the core function is conserved, there may be species-specific variations in MinJ structure that reflect adaptation to different cellular environments or division mechanisms.

  • Evolutionary implications: The presence of MinJ in a specific bacterial clade, coupled with its absence in others (like E. coli) that use alternative Min systems, highlights divergent evolutionary solutions to the fundamental problem of division site selection .

This conservation pattern supports the idea that MinJ represents a specialized adaptation in Gram-positive bacteria that enables a non-oscillatory Min system compatible with both vegetative growth and sporulation.

What happens when an oscillating Min system is introduced into B. subtilis?

Introduction of an oscillating Min system into B. subtilis produces striking effects that reveal important evolutionary and functional insights:

  • Successful oscillation: When E. coli Min proteins are introduced into B. subtilis, they can reproduce oscillatory behavior similar to that observed in E. coli, with comparable oscillation cycle times .

  • Inhibition of sporulation: Evidence suggests that this oscillatory behavior inhibits the sporulation process in B. subtilis, which normally begins with asymmetrical cell division .

  • Evolutionary significance: This inhibitory effect suggests that the non-oscillatory nature of the native B. subtilis Min system is not merely a different solution to the same problem, but an evolutionarily important adaptation specifically compatible with efficient asymmetrical septum formation during sporulation .

  • Mechanistic implications: The incompatibility between Min oscillation and sporulation likely stems from the need for stable protein gradients during the asymmetric division process, which would be disrupted by oscillatory dynamics .

These findings highlight how different Min system mechanisms reflect not just alternate solutions to division site selection, but adaptations to specific developmental capabilities of different bacterial species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.