Recombinant Bacillus subtilis Choline transport system permease protein opuBD (opuBD)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression and Purification

The recombinant OpuBD protein is produced in E. coli using the following parameters :

ParameterDetails
Expression SystemE. coli BL21
VectorpASK-IBA6 derivative with tet promoter
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer (6% trehalose, pH 8.0) at -80°C
ReconstitutionDeionized water with 5–50% glycerol to prevent aggregation

Functional Role in the OpuB Transporter

OpuBD functions as the permease component of the OpuB ABC transporter, which is part of a choline-specific import system . Key functional insights include:

  • Substrate Specificity: OpuB selectively imports choline and arsenocholine but lacks affinity for glycine betaine .

  • Mechanism: ATP hydrolysis by the OpuBA ATPase drives choline import, with OpuBC (a substrate-binding protein) delivering choline to the OpuBD permease .

  • Osmotic Regulation: OpuB is induced under high osmolality to prioritize choline uptake for glycine betaine synthesis .

Comparative Analysis of Opu Transporters

OpuBD’s role is distinct from other B. subtilis osmoprotectant transporters:

TransporterTypeSubstratesAffinity (Km)
OpuB (OpuBD)ABC transporterCholine, arsenocholine~30 µM (choline)
OpuCABC transporterGlycine betaine, choline-O-sulfate, etc.4–7 µM
OpuDBCCT familyGlycine betaineLow micromolar range

Research Findings

  • Binding Specificity: Structural studies of OpuBC (the binding protein partner) reveal choline’s trimethylammonium group interacts with an aromatic cage of tyrosine residues, while its hydroxyl group binds Gln19 . Mutating Gln19 reduces choline affinity by 15-fold .

  • Osmoprotection Hierarchy: OpuB is prioritized under sulfur-limiting conditions due to choline-O-sulfate uptake via OpuC .

  • Genetic Redundancy: opuBD deletion strains retain partial choline uptake via OpuC, highlighting functional overlap .

Applications in Research

Recombinant OpuBD is primarily used for:

  • Mechanistic Studies: Investigating ABC transporter architecture and substrate translocation .

  • Osmoadaptation Research: Characterizing choline uptake kinetics under osmotic stress .

  • Protein-Protein Interaction Assays: Reconstituting OpuB transporter complexes in vitro .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please communicate with us. We will prioritize development of the specified tag.
Synonyms
opuBD; proZ; BSU33700; Choline transport system permease protein OpuBD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
opuBD
Target Protein Sequence
MNVLEQLMTYYAQNGSYVMDEFGRHFLMSAYGVLFAAVVGVPAGILIAHFRRLSAWVFAV TNVIQTIPALAMLAVLMLVMGLGANTVILSLFLYSLLPIIRNTYTGIISIEHAYLESGKA MGMTKFQVLRMVELPLALSVIMAGLRTALVIAIGITAIGTFVGAGGLGDMIVRGSNATNG TAIILAGAIPTAVMAVGADLLMAWLERALSPVKKKRTGAKHVQSAA
Uniprot No.

Target Background

Function
This protein is involved in a high-affinity, multicomponent, binding-protein-dependent transport system for choline. It is likely responsible for the translocation of the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.