Recombinant Bacillus subtilis ComG operon protein 2 (comGB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request; however, additional charges will apply. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C, while lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
comGB; comG2; BSU24720; ComG operon protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-323
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
comGB
Target Protein Sequence
MTAGGYTLLDGLRLMELQMNKRQAADLTDSVTCLREGAPFYQVLKSLSFHKEAVGICYFA ETHGELPASMIQSGELLERKIAQADQLKRVLRYPLFLIFTVAVMFYMLQSIIIPQFSGIY QSMNMETSRSTDMLFAFFQHIDLVIILLVLFTAGIGIYYWLVFKKKSPARQMLICIRIPL VGKLVKLFNSYFFSLQLSSLLKSGLSIYDSLNAFKHQTFLPFYRCEAEQLIERLKAGESI ESAICGSLFYETDLSKVISHGQLSGRLDRELFTYSQFILQRLEHKAQKWTGILQPMIYGF VAAMILLVYLSMLVPMYQMMNQM
Uniprot No.

Target Background

Function

Required for transformation and DNA binding.

Database Links
Protein Families
GSP F family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of ComGB in Bacillus subtilis transformation?

ComGB is an integral membrane protein encoded by the comG operon that is essential for DNA binding during natural transformation in Bacillus subtilis. Studies using deletion mutants have demonstrated that strains lacking ComGB (comGΔB) are completely deficient in transformation ability, with undetectable transformation of chromosomal markers . ComGB shares similarity with morphogenetic proteins like PilC from Pseudomonas aeruginosa, suggesting its involvement in the assembly of type 4 pili-like structures that facilitate DNA binding to the cell surface . These structures are critical components of the DNA uptake machinery during the competence stage, enabling B. subtilis to bind and internalize transforming DNA from the environment.

How is the comG operon organized and regulated?

The comG operon consists of seven open reading frames (ORFs) that encode proteins essential for DNA binding during natural competence in B. subtilis. The organization includes comGA, comGB, comGC, comGD, comGE, comGF, and comGG. Among these, ComGC, ComGD, ComGE, and ComGG possess hydrophobic N-termini with cleavage sites characteristic of type 4 prepilins, while ComGA is predicted to be a nucleotide-binding protein . The expression of the comG operon is regulated as part of the competence regulon, which is activated during the transition to stationary phase or under nutrient limitation conditions.

The regulation involves a complex cascade of transcription factors, with ComK serving as the master regulator of competence genes. Experimental approaches to study this regulation typically include:

TechniqueApplicationKey Considerations
Reporter gene fusionsMonitoring promoter activityUse of lacZ or gfp reporters fused to comG promoter
Western blottingQuantifying protein expressionRequires specific antibodies against ComG proteins
RT-qPCRMeasuring transcript levelsRNA isolation must preserve short-lived competence transcripts

What methodologies are effective for generating non-polar mutations in comGB?

Creating non-polar mutations in comGB requires techniques that do not disrupt the expression of downstream genes in the comG operon. Based on published methodologies, the following approach has proven effective:

  • Design deletion constructs that maintain the reading frame and preserve ribosome binding sites for downstream genes.

  • Clone the mutated allele into a suitable plasmid vector containing a selectable marker (e.g., chloramphenicol resistance) .

  • Transform the construct into wild-type B. subtilis strain (e.g., BD630) and select for the marker .

  • Initial single crossover events will result in duplication of the target region with both wild-type and mutant copies.

  • Grow transformants without selection to allow for second crossover events and screen for loss of the marker.

  • Verify candidates using PCR and confirm the non-polar nature by Western blotting to detect downstream gene products .

This method has been successfully used to create comGΔA and comGΔB strains where the non-polar nature was confirmed by detecting ComGG expression using specific antisera .

How can ComGB protein expression be verified in recombinant strains?

Verification of ComGB expression in recombinant B. subtilis strains requires a combination of molecular and biochemical techniques:

  • Western blotting: Prepare membrane fractions from recombinant strains and analyze using anti-ComGB antibodies. This method can confirm both the presence and the correct size of the protein .

  • Functional complementation: Transform comGΔB mutants with plasmids containing the wild-type comGB gene and assess restoration of transformation ability.

  • Fluorescence microscopy: Create fluorescent protein fusions (e.g., ComGB-GFP) to visualize localization patterns, similar to techniques used for other surface-displayed proteins in B. subtilis .

  • Flow cytometry: This method can provide quantitative data on surface-expressed proteins when combined with immunofluorescence labeling .

For optimal results, protein expression should be measured after different incubation periods, as B. subtilis produces extracellular proteases that can degrade heterologous proteins over time .

What strategies can optimize the surface display of ComGB-fusion proteins in B. subtilis?

Surface display of ComGB-fusion proteins requires careful design of expression systems that maintain proper membrane insertion and functionality. Based on successful surface display strategies in B. subtilis, the following methodological approach is recommended:

  • Promoter selection: Utilize strong, constitutive promoters like the MWP promoter from Bacillus brevis for high-level expression .

  • Optimize the ribosome binding site: Implement the consensus RBS sequence (AAAGGAGG) with an optimal spacing of 7-9 nucleotides between the RBS and start codon .

  • Design fusion constructs: For N-terminal fusions, preserve ComGB's membrane-targeting sequences; for C-terminal fusions, ensure the fusion partner does not interfere with membrane insertion.

  • Expression timing: Monitor protein expression at different growth phases, with optimal expression typically occurring after 8 hours of incubation to minimize proteolytic degradation .

  • Strain engineering: Consider using protease-deficient B. subtilis strains to enhance stability of the fusion protein.

Experimental validation should include Western blotting, immunofluorescence microscopy, and functional assays to confirm both expression and proper localization of the fusion protein .

How does ComGB interact with other ComG proteins to facilitate DNA binding?

The interaction between ComGB and other ComG proteins forms a complex machinery essential for DNA binding during transformation. Current research suggests the following interaction model:

  • ComGA (a nucleotide-binding protein) likely provides energy through ATP hydrolysis for the assembly of the DNA uptake complex .

  • ComGB, as an integral membrane protein, serves as an assembly platform for the pilin-like proteins ComGC, ComGD, ComGE, and ComGG .

  • The prepilin-like proteins are processed by ComC, a dedicated peptidase, before assembly into pilus-like structures .

Methodological approaches to study these interactions include:

TechniqueInformation ProvidedLimitations
Bacterial two-hybrid assaysDirect protein-protein interactionsMay not reflect in vivo membrane environment
Co-immunoprecipitationProtein complexes in native conditionsRequires specific antibodies for each ComG protein
Blue native PAGEIntact membrane protein complexesComplex interpretation for multiple component systems
Cryo-electron microscopyStructural arrangement of the complexTechnically challenging for membrane complexes

Research has demonstrated that all seven ComG proteins are essential for transformation, as individual deletion of any comG gene results in complete loss of transformability and DNA binding capacity .

What are the challenges in expressing functional recombinant ComGB and how can they be overcome?

Expression of functional recombinant ComGB presents several challenges due to its nature as an integral membrane protein. Key challenges and solutions include:

  • Membrane insertion and topology:

    • Challenge: Ensuring proper membrane insertion with correct orientation

    • Solution: Preserve native signal sequences and utilize B. subtilis-specific expression systems rather than heterologous hosts

  • Protein stability:

    • Challenge: B. subtilis produces numerous extracellular proteases that can degrade recombinant proteins

    • Solution: Optimize harvest timing (typically 8 hours of incubation) or use protease-deficient strains

  • Functional validation:

    • Challenge: Confirming that recombinant ComGB retains functionality

    • Solution: Develop complementation assays using comGΔB strains and measure transformation efficiency

  • Expression levels:

    • Challenge: Balancing expression levels to avoid toxicity while maintaining functionality

    • Solution: Employ inducible promoter systems with titratable expression levels

For lifespan engineering approaches with recombinant B. subtilis strains, knockout of autolysis genes (lytC, sigD, pcfA, and flgD) has shown promise in increasing biomass by 10-20% , which could potentially improve recombinant protein yields.

How can chronological lifespan engineering be applied to improve ComGB expression in recombinant B. subtilis strains?

Chronological lifespan engineering offers promising strategies to enhance the stability and productivity of recombinant B. subtilis strains expressing ComGB. This approach focuses on reducing autolysis and improving cell robustness, which can be particularly beneficial for membrane proteins like ComGB.

Based on recent research findings, the following methodological framework is recommended:

  • Knockout of autolysis genes:

    • Target specific autolysis genes like lytC, sigD, pcfA, and flgD, which have demonstrated biomass increases of 20%, 17%, 12%, and 11% respectively in B. subtilis 168 .

    • Implement CRISPR-Cas9 or traditional homologous recombination methods for precise gene editing.

  • Elimination of prophage elements:

    • Delete prophage-associated genes like xpf, which has shown a 10% increase in biomass .

  • Modification of sporulation pathways:

    • Consider knockouts of spore-associated regulatory factors like spo0A or spore-associated autolysis enzyme genes (skfA, sdpC, spoIIE) .

  • Implementation of fed-batch strategies:

    • Apply DO-stat fed-batch fermentation strategies in bioreactors to maintain optimal growth conditions .

A systematic approach would involve creating a series of engineered chassis strains with combinations of these modifications, followed by transformation with ComGB expression constructs and evaluation of protein yield and functionality.

What structural features distinguish ComGB from other membrane proteins involved in DNA uptake systems?

ComGB possesses distinctive structural features that differentiate it from other membrane proteins involved in DNA uptake systems. While detailed structural information is limited, functional and comparative analyses reveal several key characteristics:

  • Homology to PilC-like proteins:

    • ComGB shares significant similarity with PilC from Pseudomonas aeruginosa, a protein essential for type 4 pili assembly .

    • This suggests a conserved role in the assembly of extracellular appendages despite evolutionary distance between gram-positive and gram-negative bacteria.

  • Membrane topology:

    • As an integral membrane protein, ComGB likely contains multiple transmembrane domains that anchor it within the cytoplasmic membrane.

    • The protein presumably has domains extending into both the cytoplasm and the extracellular space to coordinate assembly of the DNA binding apparatus.

  • Functional domains:

    • Predicted interaction sites for ComGA (the associated ATP-binding protein)

    • Assembly interfaces for the pilin-like ComG proteins (ComGC, ComGD, ComGE, and ComGG)

Research methodologies to further characterize these structural features include:

ApproachApplicationConsiderations
Membrane protein crystallographyHigh-resolution structure determinationTechnically challenging for integral membrane proteins
Cryo-electron microscopyVisualization of protein complexesMay require stabilization of protein-protein interactions
Site-directed mutagenesisIdentification of functional domainsShould target conserved residues identified through sequence alignment
Cross-linking studiesMapping of protein interaction interfacesRequires optimization of cross-linking conditions for membrane proteins

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.