Recombinant Bacillus subtilis ComG operon protein 5 (comGE)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant comGE

The recombinant Bacillus subtilis ComG operon protein 5 (comGE) is a pseudopilin component essential for bacterial genetic competence and DNA uptake. Native comGE is part of the ComG operon, which encodes proteins forming a pilus-like structure that facilitates exogenous DNA binding and internalization. The recombinant version is typically expressed in E. coli and purified via His-tag affinity chromatography, enabling detailed functional and structural studies .

Primary Sequence and Modifications

Recombinant comGE corresponds to the mature protein (residues 8–115) without the N-terminal signal peptide. Key features include:

  • Amino Acid Sequence:
    FSTIETMSALSLWLFVLLTVVPLWDKLMADEKMAESREIGYQMMNESISKYVMSGEGAAS KTITKNNHIYAMKWEEEGEYQNVCIKAAAYKEKSFCLSILQTEWLHAS .

  • Post-Translational Modifications:

    • His-Tag: N-terminal tag for purification .

    • Signal Peptide Cleavage: Native comGE is processed by ComC peptidase, but the recombinant form lacks the signal peptide (residues 1–7) .

PropertyValue/Description
UniProt IDP25957
Protein Length108 amino acids (mature)
Expression HostE. coli
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0

Functional Role in Genetic Competence

comGE is a minor pseudopilin in the ComG operon, contributing to the assembly of the pilus-like structure for DNA uptake. Key roles include:

  • Pseudopilus Assembly:

    • ComGC (major pilin) and ComGD, ComGE, ComGG (minor pilins) form a multimeric complex anchored to the cytoplasmic membrane .

    • The pseudopilus facilitates DNA binding and retraction, mediated by the ATPase ComGA .

  • DNA Uptake Mechanism:

    • Pseudopilus dynamics are polar-localized, with DNA-induced stabilization of the static pilus fraction .

    • ComC peptidase processes pseudopilin precursors, enabling membrane anchoring and aminomethylation of phenylalanine residues .

Key Studies

  1. Genetic Competence Regulation:

    • Disruption of comN (previously yrzD) reduces comE operon expression but does not directly affect comGE .

    • comGE is part of the ComG operon, distinct from the comE operon, highlighting operon-specific roles in competence .

  2. Structural Insights:

    • Pseudopilins bypass Sec/Tat pathways, relying on the Com pathway for secretion .

    • ComGA ATPase may dual-function in pilus assembly and DNA retraction .

Biotechnological Relevance

ApplicationDescription
Protein ExpressionHis-tagged comGE serves as a model for studying pseudopilin biogenesis .
DNA Uptake SystemsRecombinant comGE aids in designing synthetic DNA transfer systems .
Biofilm StudiesPseudopilins influence biofilm formation; comGE mutants may clarify this role .

Expression and Purification

  • Host: E. coli .

  • Tag: N-terminal His-tag for Ni-NTA affinity purification .

  • Reconstitution: Dissolve in sterile deionized water (0.1–1.0 mg/mL) with 50% glycerol for long-term storage at -20°C/-80°C .

Critical Notes

  • Stability: Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for ≤1 week .

  • Functionality: SDS-PAGE confirms purity but does not validate biological activity .

Comparison with Other Pseudopilins

ProteinRoleKey Feature
ComGCMajor pilin componentHydrophobic H-domain for pilus assembly
ComGEMinor pilin componentProcessed by ComC peptidase
ComGGMinor pilin componentUncharacterized in DNA uptake

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
comGE; comG5; BSU24690; ComG operon protein 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
8-115
Protein Length
Full Length of Mature Protein
Species
Bacillus subtilis (strain 168)
Target Names
comGE
Target Protein Sequence
FSTIETMSALSLWLFVLLTVVPLWDKLMADEKMAESREIGYQMMNESISKYVMSGEGAAS KTITKNNHIYAMKWEEEGEYQNVCIKAAAYKEKSFCLSILQTEWLHAS
Uniprot No.

Target Background

Function
Essential for transformation and DNA binding.
Database Links
Subcellular Location
Cell membrane; Single-pass membrane protein. Cell surface. Note=The unprocessed form is an integral membrane protein. Upon cleavage, it is translocated to the outer face of the membrane.

Q&A

What is the structural composition of the ComG operon in Bacillus subtilis?

The comG operon in Bacillus subtilis contains seven open reading frames that encode proteins essential for DNA binding during natural genetic transformation. These proteins exhibit similarities to gene products required for the assembly of type 4 pili and for protein secretion in gram-negative bacteria . The comG operon includes genes encoding four pseudopilin proteins (ComGC, ComGD, ComGE, and ComGG) that are processed by a mechanism requiring ComC . These pseudopilin signal peptides have an average length of 33 residues, with a distinctive C-domain featuring a K-G-F consensus sequence at positions -2 to +1 relative to the signal peptidase cleavage site .

How does ComGE contribute to bacterial transformation?

ComGE functions as part of a pseudopilin complex required for the binding and uptake of exogenous DNA during genetic competence development in B. subtilis . After processing by ComC, the hydrophobic H-domains of these pseudopilins represent the N-termini of mature proteins, which are thought to form pilin-like structures attached to the cytoplasmic membrane . Unlike typical secretory proteins, pseudopilin precursors bypass the Tat and Sec pathways and are transported via the specific Com pathway . This specialized transport mechanism ensures proper positioning of the ComG proteins for their role in DNA binding during the transformation process.

What is the relationship between ComGE and other ComG proteins?

ComGE is one of four pseudopilin proteins in B. subtilis (alongside ComGC, ComGD, and ComGG) that work together in a coordinated manner to facilitate DNA binding during natural transformation . These proteins share structural similarities but may have distinct functions within the DNA uptake machinery. The pseudopilin signal peptides of these proteins share common features, including the distinctive K-G-F consensus sequence at the cleavage site . Though each protein has a specific role, they collectively form a complex that resembles type IV pilins found in gram-negative bacteria, with the hydrophobic domains forming the core of pilin-like structures attached to the cytoplasmic membrane .

What processing mechanisms are required for ComGE maturation?

The maturation of ComGE requires processing by ComC, which functions as a pseudopilin signal peptidase . Unlike standard signal peptidases that cleave at the exterior side of the membrane, ComC acts at the cytoplasmic side of the membrane . In addition to processing, ComC is responsible for aminomethylation of the phenylalanine at position +1 relative to the cleavage site . This post-translational modification is critical for the proper functioning of the mature ComGE protein. The processing of ComGE differs significantly from standard secretory proteins, as the pseudopilin precursors bypass the traditional Tat and Sec pathways and are transported via the specific Com pathway .

How can genetic code expansion be utilized to study ComGE function?

Genetic code expansion offers a powerful approach for studying ComGE function by enabling the incorporation of non-standard amino acids (nsAAs) at specific positions within the protein. Researchers have demonstrated broad and efficient genetic code expansion in B. subtilis, incorporating up to 20 distinct nsAAs using different genetic code expansion systems . For ComGE research, this technique allows:

  • Click-labelling: By incorporating azide or alkyne-containing amino acids into ComGE, researchers can utilize bio-orthogonal click chemistry to specifically label the protein for visualization or pull-down experiments.

  • Photo-crosslinking: Incorporation of photo-reactive amino acids enables precise mapping of protein-protein interactions between ComGE and other components of the transformation machinery upon UV irradiation.

  • Translational titration: Non-standard amino acids can be used to modulate ComGE expression levels, allowing researchers to precisely control protein abundance and study dosage effects on transformation efficiency .

This methodology provides insights into ComGE structure-function relationships that would be difficult to obtain using conventional mutagenesis approaches.

What evolutionary relationships exist between ComGE and similar proteins in other bacterial species?

Comparative genomic analysis reveals significant evolutionary relationships between B. subtilis ComGE and similar proteins in other bacterial species. In Streptococcus mutans, a nine-gene comY operon (named comYA-I) required for natural competence has been identified and characterized . The fifth to seventh orfs in this operon (ComYE-G) match conserved hypothetical proteins from various species of Streptococcus, with ComYF possessing a predicted ComGF domain .

The conservation of these competence proteins across diverse bacterial species suggests a common ancestry and highlights the evolutionary importance of DNA uptake mechanisms. The variations in operon structure and protein sequence likely reflect adaptations to species-specific requirements for DNA binding and uptake. Understanding these evolutionary relationships can provide insights into the core functional domains of ComGE and guide targeted mutagenesis studies.

How do protein-protein interactions involving ComGE contribute to competence development?

The pilin-like structure formed by ComG proteins, including ComGE, is critical for DNA binding during competence. Identifying the specific protein-protein interactions involving ComGE is essential for understanding competence mechanism. Advanced techniques including:

  • In vivo photo-crosslinking using genetic code expansion to incorporate photo-reactive amino acids at specific positions in ComGE can capture transient interactions with other competence proteins .

  • Pull-down assays coupled with mass spectrometry can identify interaction partners of ComGE during different stages of competence development.

  • Bacterial two-hybrid systems can validate direct interactions between ComGE and other components of the transformation machinery.

Research indicates that the four pseudopilins (ComGC, ComGD, ComGE, and ComGG) interact to form pilin-like structures attached to the cytoplasmic membrane . These structures facilitate the binding and uptake of exogenous DNA, with each component potentially playing a distinct role in the assembly or function of the complex.

What are the optimal expression conditions for recombinant ComGE production?

For efficient production of recombinant ComGE, the following protocol is recommended based on current research findings:

ParameterOptimal ConditionNotes
Expression HostB. subtilis (preferred) or E. coli BL21(DE3)B. subtilis provides native processing machinery
Growth MediumM.A. or M.B. culture mediaTissue viability maintained for 12 hours
InductionIPTG (0.5-1.0 mM)For T7-based expression systems
Temperature30°C post-inductionReduces inclusion body formation
Co-expressionConsider ComC co-expressionEnsures proper processing of ComGE
Bacterial Concentration2.0 × 10^7 CFU/mlOptimal for protein expression

When expressing ComGE in heterologous systems, it's crucial to consider the presence of processing machinery. The pseudopilin signal peptidase (ComC) is essential for proper processing of ComGE . Additionally, the expression of ComGE should be optimized to ensure proper folding and to prevent the formation of inclusion bodies that could affect protein functionality.

What techniques are effective for studying ComGE localization and function?

Multiple complementary techniques can be employed to study ComGE localization and function:

  • Fluorescence microscopy: By fusing ComGE with fluorescent proteins or using genetic code expansion to incorporate click-compatible amino acids for subsequent fluorescent labeling , researchers can visualize the subcellular localization of ComGE during competence development.

  • Immunogold electron microscopy: This technique provides high-resolution visualization of ComGE within the cell membrane and associated structures.

  • Fractionation studies: Separation of cellular compartments followed by Western blotting can determine the distribution of ComGE between the cytoplasm, membrane, and extracellular fractions.

  • Genetic complementation: Expression of ComGE variants in comGE knockout strains can identify functional domains essential for transformation.

  • Pull-down assays: Using tagged ComGE to identify interaction partners that may shed light on its function within the competence machinery.

The choice of technique depends on the specific aspect of ComGE biology being investigated, and often a combination of approaches yields the most comprehensive insights.

How can researchers analyze the impact of ComGE mutations on transformation efficiency?

To analyze the impact of ComGE mutations on transformation efficiency, researchers should implement a systematic approach:

  • Site-directed mutagenesis: Target conserved residues, particularly within the K-G-F consensus sequence at the cleavage site , and the hydrophobic H-domain that forms the N-terminus of the mature protein.

  • Genetic code expansion: Incorporate non-standard amino acids to introduce specific chemical properties or photo-crosslinking capabilities at positions of interest .

  • Transformation assay protocol:

    • Grow B. subtilis strains carrying ComGE variants to mid-logarithmic phase

    • Induce competence using appropriate media and conditions

    • Add plasmid or chromosomal DNA containing a selectable marker

    • Plate dilutions on selective and non-selective media

    • Calculate transformation efficiency as the ratio of transformants to total viable cells

  • Protein expression analysis: Confirm proper expression and processing of ComGE variants using Western blotting with specific antibodies.

  • Structural analysis: Use circular dichroism or other biophysical techniques to assess the impact of mutations on ComGE structure.

This comprehensive approach allows researchers to correlate specific structural features of ComGE with its function in natural transformation.

How should researchers interpret conflicting data on ComGE function across different bacterial species?

When confronted with conflicting data on ComGE function across different bacterial species, researchers should consider several factors:

  • Evolutionary divergence: ComG proteins show varying degrees of conservation across bacterial species. For instance, the ComYE protein in Streptococcus mutans may share functional similarities with ComGE in B. subtilis, but sequence divergence can lead to species-specific adaptations .

  • Methodological differences: Variations in experimental approaches, including expression systems, purification methods, and functional assays, can contribute to apparently conflicting results.

  • Contextual dependencies: The function of ComGE may depend on the presence of specific interaction partners or environmental conditions that vary between experimental systems.

  • Differential regulation: Expression and activity of ComGE homologs may be regulated differently across species, leading to functional differences.

To reconcile conflicting data, researchers should:

  • Perform direct comparative studies using standardized methods

  • Consider the entire competence machinery rather than isolated components

  • Validate findings using multiple complementary approaches

  • Acknowledge species-specific adaptations when interpreting results

What statistical approaches are most appropriate for analyzing ComGE-mediated transformation data?

Appropriate statistical analysis of ComGE-mediated transformation data requires careful consideration of the data structure and experimental design:

  • For transformation efficiency comparisons:

    • Use log-transformation of efficiency data to normalize distributions

    • Apply ANOVA followed by appropriate post-hoc tests (e.g., Tukey's HSD) for multiple comparisons

    • Consider non-parametric alternatives (e.g., Kruskal-Wallis) if normality assumptions are violated

  • For dose-response relationships:

    • Fit appropriate models (e.g., logistic or Hill equation) to characterize the relationship between ComGE expression levels and transformation efficiency

    • Use regression analysis to quantify the strength and significance of these relationships

  • For time-course experiments:

    • Apply repeated measures ANOVA or mixed-effects models to account for within-subject correlations

    • Consider time series analysis techniques for complex temporal patterns

  • For protein-protein interaction studies:

    • Use appropriate controls and statistical tests to distinguish specific from non-specific interactions

    • Consider Bayesian approaches for integrating multiple data sources

When reporting results, include measures of effect size alongside p-values to convey the biological significance of observed differences in ComGE function or activity.

How can researchers integrate ComGE structural data with functional outcomes in transformation?

Integrating structural and functional data requires a multifaceted approach:

  • Structure-function mapping: Systematically mutate key residues identified from structural studies and assess the impact on transformation efficiency. Focus on:

    • The K-G-F consensus sequence at the cleavage site

    • Hydrophobic residues in the H-domain that may mediate protein-protein interactions

    • Conserved residues across ComGE homologs from different species

  • Molecular modeling: Use homology modeling based on related pilin structures to predict ComGE structure and potential interaction interfaces.

  • Correlation analysis: Calculate statistical correlations between structural parameters (e.g., hydrophobicity, charge distribution) and functional outcomes (e.g., transformation efficiency).

  • Integrative visualization: Develop visual representations that map functional data onto structural models to identify patterns and generate new hypotheses.

  • Machine learning approaches: Apply supervised learning algorithms to identify complex relationships between structural features and functional outcomes that may not be apparent through conventional analysis.

This integrated approach can reveal how specific structural elements of ComGE contribute to its role in DNA binding and transformation, guiding rational design of ComGE variants with enhanced or altered functionality.

How might genetic code expansion technologies enhance ComGE research?

Genetic code expansion offers transformative possibilities for ComGE research by enabling site-specific incorporation of non-standard amino acids with unique chemical properties:

  • Photoactivatable amino acids can be incorporated at specific positions in ComGE to capture transient protein-protein interactions within the transformation machinery . Upon UV irradiation, these amino acids form covalent crosslinks with nearby proteins, allowing identification of interaction partners even for weak or transient associations.

  • Click-chemistry compatible amino acids containing azide or alkyne groups can be incorporated into ComGE for subsequent labeling with fluorophores, affinity tags, or other functional moieties . This approach enables precise visualization or purification of ComGE without relying on potentially disruptive fusion tags.

  • Environmentally sensitive amino acids that change their properties in response to pH, oxidation, or other factors can provide insights into the local environment of specific ComGE residues during the transformation process.

  • Translational titration using genetic code expansion allows precise control over ComGE expression levels, enabling detailed dose-response studies of its role in transformation .

The application of these technologies to ComGE research can reveal mechanistic details that traditional approaches cannot access, particularly regarding the dynamic assembly and function of the transformation machinery.

Genetic Code Expansion StrategyApplication to ComGE ResearchExpected Insight
Photo-crosslinkingIncorporation of p-benzoyl-L-phenylalanineIdentification of direct interaction partners
Click chemistryIncorporation of azidohomoalanineVisualization of ComGE localization during competence
Environmental sensingIncorporation of fluorescent amino acidsConformational changes during DNA binding
Translational titrationIncorporation of amino acids with varying incorporation efficiencyDose-dependent effects on transformation

What is the potential for engineering ComGE to enhance DNA delivery for biotechnology applications?

The natural role of ComGE in DNA binding and uptake presents opportunities for biotechnological applications through protein engineering:

  • Enhanced transformation efficiency: By engineering ComGE to optimize its DNA binding and processing capabilities, researchers could develop B. subtilis strains with significantly improved transformation efficiencies, facilitating genetic manipulation for industrial applications.

  • Expanded DNA substrate range: Modified ComGE variants could potentially bind and facilitate the uptake of DNA substrates that are normally poor templates for natural transformation, such as methylated DNA or certain DNA structures.

  • Cell-specific DNA delivery: By incorporating targeting domains into engineered ComGE proteins, it might be possible to develop systems for selective DNA delivery to specific cell types, with applications in synthetic biology and targeted genetic manipulation.

  • Controlled competence induction: Engineering ComGE regulation could enable precise temporal control over competence development, allowing transformation to be triggered on demand without disrupting other cellular processes.

The successful engineering of ComGE for these applications would require detailed understanding of its structure-function relationships, interaction partners, and regulatory mechanisms. The genetic code expansion approaches discussed earlier could provide valuable tools for this engineering process.

What are the key quality control parameters for recombinant ComGE preparations?

Ensuring the quality of recombinant ComGE preparations is essential for reliable experimental outcomes. Key quality control parameters include:

  • Purity assessment:

    • SDS-PAGE analysis showing >95% purity

    • Mass spectrometry to confirm protein identity and detect modifications

    • Size-exclusion chromatography to assess aggregation state

  • Proper processing verification:

    • Western blotting with antibodies specific to processed ComGE

    • Mass spectrometry to confirm correct cleavage by ComC and the presence of aminomethylation at the phenylalanine residue

  • Functional validation:

    • Complementation assays in comGE knockout strains

    • DNA binding assays to confirm activity

    • Protein-protein interaction assays with known partners

  • Stability assessment:

    • Thermal shift assays to determine melting temperature

    • Long-term storage stability at different temperatures

    • Freeze-thaw stability over multiple cycles

  • Endotoxin testing:

    • Limulus amebocyte lysate (LAL) assay to ensure preparations are endotoxin-free, particularly important for in vivo applications

Maintaining consistent quality control across different ComGE preparations is crucial for reproducible research and valid comparisons between experiments.

How should researchers design controls for ComGE expression and functional studies?

Proper control design is essential for rigorous ComGE research:

  • Expression controls:

    • Empty vector control to account for effects of the expression system

    • Expression of an unrelated protein of similar size to control for metabolic burden

    • Wild-type ComGE expression as a positive control when studying variants

  • Processing controls:

    • ComGE variant with mutated cleavage site to demonstrate the importance of processing

    • Co-expression with inactive ComC to show dependence on proper processing machinery

  • Functional controls:

    • Complete comG operon deletion as a negative control for transformation assays

    • Complementation with wild-type comGE as a positive control

    • Dose-response studies with varying ComGE expression levels

  • Species-specific controls:

    • When comparing ComGE function across species, include species-specific positive controls

    • Consider chimeric proteins to map species-specific functional domains

  • Technical controls:

    • Include biological replicates (independent transformants or protein preparations)

    • Technical replicates to assess experimental variability

    • Include time course measurements to capture dynamic processes

Thoughtfully designed controls enable confident interpretation of results and help distinguish ComGE-specific effects from experimental artifacts or general perturbations to cellular physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.