Recombinant Bacillus subtilis Competence regulatory protein ComQ (comQ)

Shipped with Ice Packs
In Stock

Description

Role in Competence Regulation

ComQ operates within a quorum-sensing system alongside ComX, ComP, and ComA (Figure 1):

Key Interactions:

Protein/ComponentFunctionInteraction with ComQ
ComXModified peptide pheromoneProcessed by ComQ to activate ComP
ComPHistidine kinasePhosphorylates ComA in response to ComX
ComAResponse regulatorActivates srfA transcription, which includes comS
ComSAnti-adaptor proteinReleases ComK from MecA/ClpC degradation complex

Regulatory Cascade:

  1. ComQ processes ComX, enabling it to bind ComP and trigger autophosphorylation .

  2. Phosphorylated ComA activates srfA, which produces ComS .

  3. ComS displaces ComK from the MecA-ClpC protease complex, allowing ComK to autoactivate and drive late competence gene expression .

Genetic Disruption Studies

  • ΔcomQ mutants: Fail to develop competence and exhibit reduced srfA and comG transcription .

  • ComK dependency: ComQ indirectly regulates ComK by modulating srfA expression, linking quorum sensing to protease-mediated ComK degradation .

Proteolytic Regulation

  • ComK stability: ComQ’s role in the ComX-ComP-ComA pathway ensures transient ComK activity by coupling its release to proteolysis via MecA/ClpCP .

  • Degradation rates: In vitro studies show ComK degradation accelerates in the absence of ComS, while ComS and MecA are degraded by ClpCP when ComS is present .

Applications in Genetic Engineering

While recombinant ComQ itself is not widely studied, its regulatory network has been exploited to enhance B. subtilis’s genetic manipulability:

  • Strain optimization: Overexpression of comK (downstream of ComQ’s pathway) increases transformation efficiency in minimal media .

  • Synthetic biology: The ComQ-ComX system is modular and adjustable, enabling programmable gene expression in biosensors or bioproduction systems .

Comparison of Competence Regulatory Proteins

ProteinMolecular WeightFunctionRegulatory Target
ComQ34.2 kDaProcesses ComX pheromoneComP-ComA two-component system
ComK19.6 kDaMaster competence regulatorLate competence genes (comG, recA)
MecA28.3 kDaBinds ComK for proteolysisClpCP protease complex

Future Directions

  • Structural studies: Elucidating ComQ’s enzymatic mechanism for ComX processing.

  • Biotechnological tools: Engineering ComQ variants to fine-tune quorum sensing in industrial B. subtilis strains .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
comQ; BSU31710; Competence regulatory protein ComQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-299
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
comQ
Target Protein Sequence
MKEIVEQNIFNEDLSQLLYSFIDSKETFSFAESTILHYVVFGGENLDVATRLGAGIEILI LSSDIMDDLEDEDNHHALWMKINRSESLNAALSLYTVGLTSIYSLNNNPLIFKYVLKYVN EAMQGQHDDITNKSKTEDESLEVIRLKCGSLIALANVAGVLLATGEYNETVERYSYYKGI IAQISGDYYVLLSGNRSDIEKNKHTLIYLYLKRLFNDASEDLLYLISHKDLYYKSLLDKE KFQEKLIKAGVTQYISVLLEIYKQKCISAIEQLNLDKEKKELIKECLLSYTKGDTRCKT
Uniprot No.

Target Background

Function

ComQ is involved in the maturation of ComX, a key component of a major quorum-sensing system that regulates the development of genetic competence in Bacillus subtilis.

Database Links
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is ComQ and what is its primary function in Bacillus subtilis?

ComQ is a 34,209-Da protein encoded by the comQ gene in Bacillus subtilis that plays a crucial role in quorum sensing. It functions primarily in the production of the ComX pheromone, which is a modified 10-amino-acid peptide used by B. subtilis to modulate changes in gene expression in response to cell population density . ComQ is both necessary and sufficient for the proteolytic cleavage and modification of pre-ComX, resulting in the active pheromone . The protein works together with ComP and ComA at the early stages of competence signaling, forming part of the ComQXPA quorum sensing system that regulates natural competence for DNA uptake .

How do you design primers for amplifying the comQ gene from Bacillus subtilis?

To amplify the comQ gene, design primers that flank the complete open reading frame. Based on published research protocols:

  • First, obtain the complete sequence of the comQ gene from genomic databases or reference strains like B. subtilis 168.

  • Design forward primers to include the start codon and potentially a restriction site for subsequent cloning.

  • Design reverse primers to include the stop codon and another compatible restriction site.

  • Optimal primer length should be 18-25 nucleotides with a GC content of 40-60% and melting temperatures between 55-65°C.

For example, in previous studies, researchers successfully amplified comQ using PCR with specific primers that included the region from the 3′ end of degQ up to but not including the comQ ribosome-binding site (using primers such as KBP31 and KBP32) . Similar approaches can be used with appropriate modifications for your specific experimental design.

What expression systems are most suitable for recombinant ComQ production?

Several expression systems have proven effective for recombinant ComQ production, each with distinct advantages:

Expression SystemAdvantagesLimitationsReported Yields
E. coli BL21(DE3)High yield, simple protocol, well-establishedPotential folding issues with membrane-associated proteinsUp to 15-20 mg/L culture
B. subtilis expressionNative post-translational modifications, natural folding environmentLower yields than E. coli, more complex genetic manipulation3-5 mg/L culture
Cell-free systemsRapid production, avoids toxicity issuesHigher cost, lower scaleVariable

The choice depends on your experimental needs. For structural studies, E. coli systems like BL21(DE3) with plasmids such as pET22(b) have been successfully used for comQ expression . For functional studies where proper protein modification is critical, B. subtilis-based expression may be preferable despite lower yields. Researchers have successfully used various plasmids (pKB58, pKB59, pKB62, pKB64-pKB69, and pKB78) in which the comX allele is under control of the comQ promoter .

What are effective strategies for purifying recombinant ComQ protein?

Purification of recombinant ComQ requires a multi-step approach:

  • Affinity Chromatography: Most researchers use His-tagged ComQ constructs for initial purification with Ni-NTA columns. Elution is typically performed with an imidazole gradient (20-250 mM).

  • Ion Exchange Chromatography: As a secondary purification step, ComQ can be further purified using cation exchange columns (SP Sepharose) due to its theoretical pI.

  • Size Exclusion Chromatography: A final polishing step using Superdex 75 or similar columns helps remove aggregates and achieve >95% purity.

The purification buffer composition is critical: typically, 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 5% glycerol, and 1 mM DTT work well for maintaining ComQ stability. Avoid harsh detergents if you intend to study functional properties, as they may disrupt protein-protein interactions critical for ComQ's enzymatic activity .

How do you design a quasi-experimental approach to study ComQ function in Bacillus subtilis?

When randomized controlled trials are not feasible, quasi-experimental designs offer robust alternatives for studying ComQ function:

  • Interrupted Time Series Design:

    • Monitor gene expression patterns before and after induced expression of comQ

    • Measure competence-related phenotypes at multiple time points

    • Analyze changes using appropriate statistical methods for time series data

  • Non-Equivalent Control Group Design:

    • Compare comQ mutants with wild-type strains under identical conditions

    • Match groups on relevant characteristics except for comQ expression

    • Control for confounding variables through statistical adjustment

  • Regression Discontinuity Design:

    • Examine competence development across a continuous variable (e.g., ComQ expression levels)

    • Identify threshold effects in quorum sensing activation

These approaches help establish causality when true experimental control is limited. For example, researchers have used quasi-experimental designs to compare comQ mutants with wild-type strains, revealing that ComQ-deficient mutants show altered biofilm formation and delayed sporulation .

What assays can be used to measure ComQ activity and function?

Several complementary assays can quantify ComQ activity:

  • ComX Pheromone Production Assay:

    • Collect culture supernatants from ComQ-expressing cells

    • Measure ComX pheromone using reporter strains expressing srfA-lacZ fusion

    • Quantify β-galactosidase activity as a proxy for ComX pheromone production

  • Competence Development Assay:

    • Transform cells with plasmid DNA and measure transformation efficiency

    • Compare competence development in ComQ+ vs. ComQ- backgrounds

    • Use fluorescent reporters (e.g., P₍ₛᵣᶠₐₐ₎-yfp) to track competence gene expression

  • Biofilm Formation Analysis:

    • Quantify pellicle biofilm formation in static cultures

    • Measure biofilm thickness, robustness, and cell arrangement

    • Analyze matrix composition (polysaccharides and proteins)

Research has shown that ComQ-deficient mutants form thicker and more robust pellicle biofilms with distinctive cell chain formations, allowing for quantitative comparison between wild-type and mutant strains .

How does ComQ interact with pre-ComX to facilitate pheromone production?

ComQ appears to function as an isoprenoid transferase that modifies pre-ComX through a specific molecular interaction:

  • Binding Interaction: ComQ binds to the pre-ComX peptide (55 amino acids) via its C-terminal region.

  • Proteolytic Processing: ComQ facilitates the cleavage of pre-ComX, isolating the C-terminal 10 amino acids.

  • Post-translational Modification: ComQ catalyzes the attachment of an isoprenyl group to a tryptophan residue in the ComX peptide. Evidence for this comes from mutational studies of a putative isoprenoid binding domain in ComQ, where mutations eliminated ComX pheromone production .

The exact binding interface remains to be fully characterized, but alanine substitution experiments have identified key residues in ComX (T50, G54, and D55) that are unlikely to interact directly with ComQ . Further structural studies using techniques like hydrogen-deuterium exchange mass spectrometry or crosslinking would help elucidate the precise interaction mechanism.

How can genetic code expansion be used to study ComQ structure and function?

Genetic code expansion offers powerful approaches to investigate ComQ:

  • Site-specific incorporation of non-standard amino acids (nsAAs):

    • B. subtilis can efficiently incorporate up to 20 distinct nsAAs into proteins using various genetic code expansion systems

    • This allows for precise chemical modification at specific sites in ComQ

  • Applications for ComQ research:

    • Photo-crosslinking: Incorporate photo-reactive amino acids (like p-benzoyl-L-phenylalanine) at predicted interaction interfaces to capture transient ComQ-ComX binding events

    • Click chemistry labeling: Introduce azide- or alkyne-containing amino acids for fluorescent labeling to track ComQ localization

    • Translational titration: Fine-tune ComQ expression levels to determine threshold effects in quorum sensing activation

  • Implementation strategy:

    • Design amber suppression systems specific for ComQ expression

    • Use orthogonal tRNA/synthetase pairs optimized for B. subtilis

    • Verify incorporation using mass spectrometry

Recent work demonstrates that B. subtilis is an excellent host for genetic code expansion, making these approaches feasible for ComQ studies .

What role does ComQ play in the evolution of quorum sensing specificity among Bacillus species?

ComQ exhibits fascinating evolutionary patterns that contribute to quorum sensing specificity:

  • Diversifying Selection: Statistical tests (ratio of synonymous/nonsynonymous substitution rates and Tajima D test) demonstrate that ComQ sequences have evolved by diversifying selection rather than neutral drift .

  • Pherotype Variation: Natural isolates of B. subtilis and related species show high polymorphism in ComQ, ComX, and ComP sequences, creating distinct "pherotypes" - groups that can detect their own quorum sensing signals but not those of other groups.

  • Co-evolution Pattern: ComQ co-evolves with ComX, which suggests that the specificity of the ComQ-ComX interaction is under selective pressure.

This evolutionary pattern may serve as a mechanism for kin recognition, allowing Bacillus populations to differentiate between closely related strains. Research applications include engineering strain-specific quorum sensing circuits and understanding the molecular basis of microbial population dynamics .

How can ComQ be used to engineer synthetic quorum sensing systems in Bacillus subtilis?

ComQ offers several opportunities for engineering synthetic quorum sensing systems:

  • Orthogonal Communication Channels:

    • Different natural ComQ/ComX pairs can be introduced to create multiple non-interfering signaling pathways

    • Each channel can control distinct output modules (e.g., different gene expression programs)

  • Tunable Signal Production:

    • Modulating ComQ expression levels through inducible promoters (e.g., Pxyl) allows precise control of signal strength

    • This enables the creation of synthetic circuits with adjustable activation thresholds

  • Signal Specificity Engineering:

    • Mutations in ComQ can be introduced to alter substrate specificity

    • Directed evolution approaches can generate ComQ variants with novel activities

Implementation involves careful genetic design, including appropriate promoter selection, ribosome binding site optimization, and integration of synthetic circuits at specific genomic loci to avoid interference with native systems .

Why is my recombinant ComQ protein inactive after purification?

Several factors may contribute to ComQ inactivity after purification:

  • Improper Folding: ComQ may require specific conditions for proper folding. Consider:

    • Using milder lysis conditions (avoid harsh detergents)

    • Adding stabilizing agents like glycerol (5-10%) to purification buffers

    • Including reducing agents (1-5 mM DTT or 2-mercaptoethanol) to maintain thiol groups

  • Loss of Cofactors: ComQ may require specific cofactors for activity:

    • If ComQ functions as an isoprenoid transferase as suggested by research , it may require prenyl donors

    • Try supplementing reaction buffers with potential cofactors like farnesyl pyrophosphate or geranylgeranyl pyrophosphate

  • Incorrect Assay Conditions: The in vitro conditions may not recapitulate the cellular environment:

    • Optimize buffer composition (pH 7.5-8.0 typically works for ComQ)

    • Adjust salt concentration (150-300 mM NaCl)

    • Include appropriate divalent cations (Mg²⁺, Mn²⁺) which may be required for activity

Activity assays using pre-ComX as a substrate can help determine if the purified ComQ is functional. Successful in vitro reconstitution of ComQ activity has been reported using properly purified components .

How do you resolve contradictory findings about ComQ function in different B. subtilis strains?

Contradictory findings about ComQ function across different B. subtilis strains can be addressed through systematic analysis:

  • Strain Verification:

    • Confirm the genetic background of all strains through whole-genome sequencing

    • Analyze the comQ locus and surrounding regions to identify polymorphisms

    • Create isogenic strains with defined comQ variants for direct comparison

  • Experimental Standardization:

    • Use consistent growth conditions, media composition, and assay protocols

    • Control for differences in growth phase when measuring ComQ-dependent phenotypes

    • Implement quantitative rather than qualitative measurements

  • Functional Complementation:

    • Introduce well-characterized comQ alleles into different strain backgrounds

    • Determine if strain-specific factors influence ComQ function

    • Test multiple comQ alleles to identify strain-specific interactions

Research has revealed significant natural variation in ComQ across Bacillus isolates, with different pherotypes showing specificity in quorum sensing responses . This natural diversity may explain seemingly contradictory findings and offers an opportunity to study the molecular basis of signaling specificity.

How does the ComQ-ComX pathway interact with other quorum sensing systems in B. subtilis?

B. subtilis employs multiple quorum sensing systems that interact with ComQ-ComX:

  • Interaction with CSF (Competence and Sporulation Factor):

    • Both ComX pheromone and CSF (PhrC) influence ComA phosphorylation

    • ComX acts through ComP to phosphorylate ComA

    • CSF acts by inhibiting the ComA-specific phosphatase RapC

    • These pathways converge on ComA~P levels, suggesting coordinated regulation

  • Cross-talk with AbrB-Spo0A Circuit:

    • The ComQ-ComX pathway influences sporulation timing

    • Research shows ComX-deficient mutants display delayed sporulation but increased synchronicity in spore formation

    • This suggests regulatory connections between quorum sensing and sporulation decisions

  • Integration with Surfactin Production:

    • ComQ activates srfA transcription through ComX-ComP-ComA signaling

    • Surfactin production influences biofilm formation

    • ComQ mutants show altered surfactin production patterns

Experimental approaches to study these interactions include dual reporter systems with fluorescent proteins under the control of different quorum-responsive promoters, allowing simultaneous visualization of multiple signaling pathways .

What computational approaches can be used to predict ComQ structure and function?

Advanced computational methods offer valuable insights into ComQ structure and function:

  • Structure Prediction:

    • AlphaFold2 or RoseTTAFold can generate high-confidence structural models of ComQ

    • Molecular dynamics simulations can refine models and predict flexible regions

    • Protein-protein docking with ComX can identify potential binding interfaces

  • Functional Site Prediction:

    • ConSurf analysis can identify evolutionarily conserved regions likely to be functionally important

    • FTSite or SiteMap can predict ligand binding pockets

    • Machine learning approaches like DeepSite can identify potential catalytic sites

  • Evolutionary Analysis:

    • PAML software can be used to detect signatures of diversifying selection in ComQ

    • Sequence co-evolution analysis (using tools like EVcouplings) can identify co-evolving residues between ComQ and ComX

    • Phylogenetic analysis can reveal the evolutionary history of ComQ variants

These computational predictions should be validated experimentally through targeted mutagenesis and functional assays. For example, mutations in putative isoprenoid binding domains of ComQ have been shown to eliminate ComX pheromone production, validating computational predictions of functional sites .

How can single-cell analysis reveal heterogeneity in ComQ-mediated quorum sensing responses?

Single-cell analysis techniques can uncover population heterogeneity in ComQ-mediated responses:

  • Fluorescent Reporter Systems:

    • Construct transcriptional fusions of quorum-responsive promoters (P₍ₛᵣᶠₐₐ₎, P₍ᵗₐₚₐ₎, P₍ₑₚₛₐ₎) with fluorescent proteins

    • Use dual reporters (e.g., P₍ₛₚₒᵢᵢq₎-yfp with P₍₄₃₎-mKate2) to track multiple cellular states

    • Analyze population distribution through flow cytometry or time-lapse microscopy

  • Microfluidic Approaches:

    • Use microfluidic devices to trap individual cells and monitor their responses to controlled ComX concentrations

    • Track lineages through cell division to identify inheritance patterns of quorum sensing responses

    • Observe transitions between different cellular states (competence, sporulation, matrix production)

  • Analysis Methods:

    • Apply computational tools to quantify gene expression noise and bimodality

    • Use mathematical modeling to predict population-level consequences of single-cell heterogeneity

    • Correlate ComQ-dependent signaling with other cellular parameters (cell size, growth rate)

Research has already revealed that ComX influences heterogeneity in sporulation, with ComX-deficient mutants showing more synchronized expression of sporulation genes compared to wild-type populations with prominent heterogeneity . This approach could reveal how ComQ-mediated signaling contributes to cellular decision-making and phenotypic diversity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.