Recombinant Bacillus subtilis Cytochrome c oxidase subunit 2 (ctaC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
ctaC; BSU14890; Cytochrome c oxidase subunit 2; Caa-3605 subunit 2; Cytochrome aa3 subunit 2; Cytochrome c oxidase polypeptide II; Oxidase aa(3 subunit 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-356
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ctaC
Target Protein Sequence
CGKPFLSTLKPAGEVADKQYDLTVLSTLIMVVVVAVVSVIFFYVIVRFRRSRVGENTIPK QVEGNKFLEITWTVIPILLLIILVIPVVLYTLELADTSPMDKKGRKAEDALVVNVRANLY WWEFEYPDYGIITSQELIVPTDQRVYFNLKASDVKHSFWIPSVGGKLDTNTDNENKFFLT FDSKRSKEAGDMFFGKCAELCGPSHALMDFKVKTMSAKEFQGWTKEMKNYKSTAESDLAK QGEELFKEKNCLSCHAVEPNDKRAEAARTAPNLATFGERTKVAGVKEANKENVKAWLKDP DSIKPGNKMTGTYPKLSDSETNALYEYLKGLKAESK
Uniprot No.

Target Background

Function

Subunits I and II constitute the enzyme complex's functional core. Electrons originating from cytochrome c are transferred via heme a and Cu(A) to the binuclear center composed of heme a3 and Cu(B).

Database Links
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.