Recombinant Bacillus subtilis Dipeptide transport system permease protein dppB (dppB)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Bacillus subtilis dipeptide transport system permease protein DppB (dppB) is a purified, engineered form of the native DppB protein, a critical component of the Dpp (dipeptide permease) ABC transporter system. This system facilitates the uptake of dipeptides and cell wall-derived muropeptides in B. subtilis, playing roles in nutrient acquisition, sporulation signaling, and cell wall recycling . Recombinant DppB is produced for biochemical and structural studies to elucidate its role in bacterial physiology and transport mechanisms.

Functional Role

  • Substrate Specificity: The Dpp system primarily transports dipeptides and murein tripeptides (MTPs), such as L-Ala-D-Glu-meso-DAP, involved in cell wall recycling .

  • Regulation: Expression of dppB is controlled by CodY, a nutrient-sensing transcription factor, under nutrient-limiting conditions .

Functional Partners and Interactions

DppB operates within a network of proteins essential for dipeptide transport:

ProteinFunctionInteraction Score
DppCPermease component; forms channel with DppB0.999
DppDATPase; energizes transport0.999
DppESubstrate-binding protein; captures extracellular dipeptides/MTPs0.999
OppAOligopeptide-binding protein; functionally overlaps with DppE0.951

Role in Sporulation and Nutrient Scavenging

  • Sporulation Signaling: The Dpp system contributes to sporulation by importing peptides that modulate the Spo0A phosphorelay, a master regulator of sporulation .

  • Cell Wall Recycling: DppB facilitates uptake of muropeptides, which are processed into signaling molecules for cell wall turnover .

Industrial and Biotechnological Relevance

Recombinant DppB is utilized to:

  1. Study ABC transporter mechanics and substrate specificity.

  2. Develop inhibitors targeting peptide uptake in Bacillus pathogens.

  3. Engineer B. subtilis strains for enhanced peptide utilization in industrial enzyme production .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag type, please specify it, and we will prioritize its development.
Synonyms
dppB; dciAB; BSU12930; Dipeptide transport system permease protein DppB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
dppB
Target Protein Sequence
MARYMIKRFWAMAATILVITTLTFVLMKVIPGSPFNEERGTNEAVQKNLEAYYHLDDPLI FQYIFYLKSIITFDFGPSIKKPSDSVNDMLERGFPVSFELGMTAIVIAVISGLVLGVIAA LRRNGFLDYAAMSLAVLGISIPNFILATLLIQQFAVNLKLFPAATWTSPIHMVLPTAALA VGPMAIIARLTRSSMVEVLTQDYIRTAKAKGLSPFKIIVKHALRNALMPVITVLGTLVAS ILTGSFVIEKIFAIPGMGKYFVESINQRDYPVIMGTTVFYSVILIIMLFLVDLAYGLLDP RIKLHKKG
Uniprot No.

Target Background

Function
This protein is likely part of the ABC transporter DppBCDE, which is involved in dipeptide transport. It is responsible for the translocation of the substrate across the membrane. These functions are probable based on current knowledge.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, OppBC subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is DppB and what role does it play in B. subtilis?

DppB functions as a critical membrane permease component of the dipeptide transport system (Dpp) in Bacillus subtilis. As part of the DppABCDF transporter complex, DppB forms one of the transmembrane domains that creates a channel through which dipeptides pass across the bacterial cell membrane. This ABC (ATP-binding cassette) transporter is crucial for bacterial nutrient acquisition, particularly for obtaining amino acids in the form of dipeptides . In the complete transport system, DppB works alongside DppC to form the membrane-spanning channel while DppD and DppF function as the nucleotide-binding domains that hydrolyze ATP to power the transport process.

How does the dipeptide transport system function mechanistically?

The dipeptide transport system in B. subtilis operates through a sophisticated ATP-dependent mechanism:

  • In the resting state, the DppBCDF translocator maintains an inward-facing conformation open to the cytoplasm

  • DppA (the substrate-binding protein) captures dipeptides from the environment

  • Substrate-bound DppA associates with the DppBCDF complex, inducing subtle conformational changes

  • This interaction enables simultaneous binding of ATP to both nucleotide-binding domains (DppD and DppF)

  • The complex transitions to an outward-facing conformation, creating a sealed substrate cavity

  • The dipeptide is released from DppA into this cavity

  • ATP hydrolysis provides energy to return the complex to an inward-facing conformation

  • The dipeptide is released into the cytoplasm, and substrate-free DppA dissociates from the complex

Importantly, the DppBCDF translocator alone does not hydrolyze ATP, which prevents futile consumption of cellular energy. This activation requires the presence of DppA, ensuring energy is only used when transport can occur .

What distinguishes the DppB protein structure from other membrane transporters?

A distinctive feature of DppB is its periplasmic "scoop motif" (α1-loop-α2 motif), which plays a crucial role in dipeptide transport. This specialized structural element prevents dipeptides from escaping back into the periplasm upon release from DppA, ensuring efficient transport across the membrane . Experimental evidence shows that mutations in this region significantly impact transport efficiency - bacterial strains expressing DppAB Δscoop-motifCDF show impaired growth, and their ATPase activity drops to approximately one-fourth of wild-type levels .

What are the optimal approaches for expressing recombinant B. subtilis DppB?

For successful recombinant expression of B. subtilis DppB:

  • Expression system selection:

    • E. coli-based systems with specialized strains optimized for membrane protein expression

    • B. subtilis expression systems that maintain native membrane environment

    • Cell-free expression systems for toxic or difficult-to-express constructs

  • Vector design considerations:

    • Include appropriate fusion tags (His, FLAG, etc.) for purification

    • Ensure signal sequences are properly engineered for membrane targeting

    • Consider inducible promoters to control expression levels

  • Optimization parameters:

    • Lower induction temperatures (16-25°C) to slow expression and aid proper folding

    • Reduced inducer concentrations to prevent inclusion body formation

    • Supplementation with appropriate lipids to support membrane protein integration

  • Validation methods:

    • Western blotting to confirm expression

    • Fluorescence-based localization to verify membrane integration

    • Functional assays to ensure the recombinant protein retains transport activity

How can researchers accurately assess DppB functionality in experimental systems?

Functional validation of DppB requires multiple complementary approaches:

  • Genetic complementation assays:

    • Transform dppB-deficient B. subtilis strains with recombinant dppB variants

    • Assess growth restoration on media with dipeptides as sole nitrogen sources

    • Monitor growth rates under various dipeptide availability conditions

  • Biochemical assessments:

    • ATPase activity assays of the reconstituted DppABCDF complex

    • Comparative analysis between wild-type and mutant systems (e.g., DppAB E41A+R42ACDF shows ~50% reduction in ATPase activity compared to wild-type)

  • Transport measurements:

    • Utilize fluorescently labeled or radiolabeled dipeptide substrates

    • Measure substrate accumulation in proteoliposomes containing reconstituted DppABCDF

    • Compare transport kinetics between different DppB variants

  • Structural validation:

    • Circular dichroism to verify proper protein folding

    • Crosslinking studies to assess complex formation

What critical sampling considerations apply when studying B. subtilis transport systems?

Accurate study of transport systems in B. subtilis requires careful attention to sampling methodology:

  • Metabolic state preservation:

    • Rapid sampling is essential to capture the true physiological state

    • The adenylate energy charge should be monitored as an indicator of sampling accuracy

    • Immediate quenching of metabolism prevents artifacts

  • Cell disruption techniques:

    • Choose methods that effectively disrupt the Gram-positive cell wall without damaging membrane proteins

    • Optimize protocols to prevent protein denaturation or aggregation

  • Membrane fraction isolation:

    • Differential centrifugation to separate membrane fractions

    • Detergent selection is critical for solubilization while maintaining function

    • Consider native membrane mimetics (nanodiscs, liposomes) for functional studies

  • Prevent experimental artifacts:

    • Minimize metabolite leakage during preparation

    • Control temperature throughout sample processing

    • Standardize growth conditions to ensure reproducibility

How does the DppB scoop motif contribute mechanistically to dipeptide transport?

The periplasmic scoop motif in DppB represents a specialized structural adaptation critical for transport efficiency:

Scoop Motif VariantATPase Activity (% of WT)Growth PhenotypeFunctional Impact
Wild-type100%NormalEfficient dipeptide transport
E41A+R42A mutations~50%Significantly impairedReduced transport efficiency
Complete deletion~25%Severely compromisedInability to form sealed substrate cavity

The scoop motif functions by:

  • Creating a physical barrier that prevents dipeptides from escaping back into the periplasm after release from DppA

  • Forming part of the sealed outward-facing substrate cavity during the transport cycle

  • Potentially guiding the substrate toward the transmembrane channel

Without this structural feature, dipeptides can readily escape into the periplasm before being transported across the membrane, resulting in inefficient nutrient acquisition and impaired bacterial growth.

What is the relationship between ATP hydrolysis and conformational changes in the DppABCDF system?

The ATP hydrolysis cycle is precisely coordinated with conformational changes in the transport complex:

  • Initial state: DppBCDF adopts an inward-facing conformation with the substrate translocation pathway open to the cytoplasm

  • Binding events:

    • In the translocator alone, binding of a single ATP molecule to DppF does not induce conformational changes

    • The DppBCDF translocator by itself shows essentially no ATPase activity, even in the presence of dipeptide substrates

    • Binding of substrate-loaded DppA to DppBCDF induces subtle conformational changes

    • This allows both ATPases (DppD and DppF) to simultaneously bind ATP

  • Conformational transition:

    • With both ATP-binding sites occupied, the complex transitions to an outward-facing conformation

    • Cryo-EM structures of DppABCDF in complex with ATP analogs reveal this conformation, with two ATP molecules positioned at the interface between DppD and DppF

  • Transport completion:

    • ATP hydrolysis provides the energy to return the complex to an inward-facing conformation

    • This conformational change completes dipeptide transport across the membrane

    • ADP-bound DppA has lower affinity for DppBCDF and dissociates

This tightly regulated mechanism prevents futile ATP consumption in the absence of actual transport events.

How can engineered DppB variants serve as research tools for studying bacterial metabolism?

Engineered DppB variants offer powerful research applications:

  • Substrate specificity studies:

    • Modified DppB proteins can help define the structural determinants of dipeptide recognition

    • Variants with altered substrate preferences allow tracking of specific dipeptide utilization pathways

  • Metabolic flux analysis:

    • Controlled expression of DppB variants enables precise regulation of dipeptide uptake

    • This allows researchers to manipulate specific amino acid availability and study downstream metabolic effects

  • Biosensor development:

    • DppB-based sensors can be engineered to detect specific dipeptides

    • Applications include monitoring metabolite production in biotechnology

  • Structural biology tools:

    • Conformationally locked DppB variants can stabilize the transporter in specific states for structural studies

    • This enables detailed analysis of the transport mechanism

  • Protein-protein interaction studies:

    • Modified DppB variants help map the interaction interfaces with other transporter components

    • This information is valuable for understanding transport complex assembly and function

What insights does DppB research provide about dipeptide transport differences between Gram-positive and Gram-negative bacteria?

Comparative analysis of DppB across bacterial types reveals important adaptations:

  • Substrate-binding protein organization:

    • In Gram-negative bacteria, substrate-binding proteins like DppA freely diffuse in the periplasmic space

    • In Gram-positive bacteria like B. subtilis, substrate-binding proteins must anchor to the membrane to prevent diffusion into the external environment

  • Transport efficiency considerations:

    • Membrane-anchored substrate-binding proteins in Gram-positive bacteria might be inefficient at accessing the translocator via lateral diffusion

    • This structural difference necessitates tight interactions between substrate-binding proteins and the translocator in Gram-positive systems

  • Energy coupling:

    • The dipeptide translocator DppBCDF alone does not hydrolyze ATP in both systems, avoiding futile ATP consumption

    • This conservation across bacterial types highlights the importance of regulated energy expenditure

  • Evolutionary adaptations:

    • The specialized scoop motif represents an adaptation to the specific membrane architecture

    • Its conservation highlights the importance of preventing substrate escape during the transport cycle

How can structural information about DppB guide the design of antimicrobial compounds?

Structural insights into DppB offer strategic approaches for antimicrobial development:

  • Transport inhibitor design:

    • Target the unique scoop motif to disrupt the transport cycle

    • Design compounds that interfere with DppA-DppB interactions

    • Develop molecules that prevent the conformational changes required for transport

  • Trojan horse strategies:

    • Engineer antimicrobial compounds conjugated to dipeptides for transport via the Dpp system

    • Utilize knowledge of substrate specificity determinants to optimize uptake

    • Target compounds specifically to bacterial species based on their DppB structure

  • Biofilm disruption:

    • DppB-targeted compounds could potentially disrupt bacterial biofilms

    • This approach draws on knowledge from studies of other transport systems in B. subtilis, where biofilm formation has been linked to transport proteins

  • Species selectivity:

    • Exploit structural differences between DppB in different bacterial species

    • Design narrow-spectrum antimicrobials that target specific pathogens

    • Minimize disruption of beneficial microbiota

How should researchers interpret conflicting data regarding DppB function across different experimental systems?

When faced with contradictory results regarding DppB function:

  • Experimental system differences:

    • Compare heterologous expression systems vs. native B. subtilis

    • Evaluate membrane composition differences that might affect function

    • Consider the presence/absence of native interaction partners

  • Assay-specific variables:

    • ATPase assays might show different results from transport assays

    • In vitro reconstituted systems may differ from in vivo measurements

    • Growth-based assays integrate multiple cellular processes beyond transport

  • Environmental conditions:

    • pH, temperature, and ionic strength affect transporter function

    • Nutrient availability alters expression of transport systems

    • Growth phase influences membrane composition and transporter activity

  • Strain-specific genetic backgrounds:

    • Compensatory mutations may mask phenotypes in some strains

    • Regulatory differences affect expression levels

    • Genetic redundancy in transport systems varies between strains

  • Statistical analysis approaches:

    • Apply appropriate statistical tests for each experimental design

    • Consider biological vs. technical replication in experimental planning

    • Use power analysis to ensure sufficient sample size

What methodological considerations are critical when designing experiments to study DppB-substrate interactions?

For accurate characterization of DppB-substrate interactions:

  • Substrate selection considerations:

    • Use chemically defined dipeptide substrates

    • Consider stereochemistry (L vs. D amino acids)

    • Test substrate panels to determine specificity profiles

  • Binding vs. transport distinction:

    • Binding assays may not reflect transport capability

    • Transport assays should measure actual substrate movement

    • ATPase stimulation doesn't necessarily correlate directly with transport rates

  • System reconstitution:

    • Ensure all components (DppA, DppB, DppC, DppD, DppF) are present in proper ratios

    • Verify complex assembly before functional assays

    • Consider using native membrane extracts vs. synthetic lipid environments

  • Control experiments:

    • Include non-transported dipeptides as negative controls

    • Use ATPase-deficient mutants to distinguish active transport from diffusion

    • Employ competitive inhibition assays to verify specificity

  • Data analysis:

    • Determine kinetic parameters (Km, Vmax) for different substrates

    • Analyze transport stoichiometry (ATP:substrate ratio)

    • Apply appropriate curve-fitting models for complex kinetics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.