Recombinant Bacillus subtilis Dipeptide transport system permease protein dppC (dppC)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Applications

dppC is primarily produced in E. coli due to its robust expression and cost-effectiveness. Key production parameters include:

ParameterValue/Detail
Genomic SourceB. subtilis strain (e.g., 168trpC2)
Cloning VectorpET-28a derivatives
Purification MethodNickel affinity chromatography (His-tag)
YieldNot explicitly reported; high-purity preparations typically >85%

Recombinant dppC is used in:

  • Structural studies: Crystallography of the Dpp complex .

  • Functional assays: Transport activity measurements using radiolabeled peptides .

  • Biotechnological applications: Protein engineering for enhanced peptide uptake in industrial strains .

Role in Peptide Transport

The Dpp system mediates the uptake of dipeptides (e.g., Pro-Gly) and murein tripeptides (MTPs), which are critical for:

  • Nutrient scavenging: Recycling cell wall-derived peptides during nutrient limitation .

  • Cell signaling: Modulating sporulation via interactions with murein peptides .

Regulation

  • CodY Regulation: Repressed by CodY during vegetative growth; induced under nutrient stress .

  • Substrate Range: While primarily a dipeptide transporter, dppC indirectly facilitates MTP uptake via dppE’s substrate-binding capacity .

Comparative Analysis of Recombinant dppC Preparations

The table below summarizes key features of recombinant dppC from diverse sources:

SourceHostTagPurityApplication
Creative Biomart E. coliHis-tag>90%Research, structural studies
MyBioSource E. coliHis-tag>85%Functional assays
Cell-free systems In vitroNative>85%High-throughput screening

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format requests. Please include your desired format in your order notes, and we will do our best to fulfill your needs.
Lead Time
Delivery times may vary depending on the purchasing method and location. For precise delivery information, please consult your local distributors.
Note: Our standard shipping practice includes normal blue ice packs. Should you require dry ice for shipping, please communicate this requirement in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our protein products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during the production process. If you have a preferred tag type, please communicate it to us, and we will prioritize its implementation.
Synonyms
dppC; dciAC; BSU12940; Dipeptide transport system permease protein DppC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-320
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
dppC
Target Protein Sequence
MNLPVQTDERQPEQHNQVPDEWFVLNQEKNREADSVKRPSLSYTQDAWRRLKKNKLAMAG LFILLFLFVMAVIGPFLSPHSVVRQSLTEQNLPPSADHWFGTDELGRDVFTRTWYGARIS LFVGVMAALIDFLIGVIYGGVAGYKGGRIDSIMMRIIEVLYGLPYLLVVILLMVLMGPGL GTIIVALTVTGWVGMARIVRGQVLQIKNYEYVLASKTFGAKTFRIIRKNLLPNTMGAIIV QMTLTVPAAIFAESFLSFLGLGIQAPFASWGVMANDGLPTILSGHWWRLFFPAFFISLTM YAFNVLGDGLQDALDPKLRR
Uniprot No.

Target Background

Function
This protein is likely part of the ABC transporter DppBCDE, which is thought to be involved in dipeptide transport. It is believed to be responsible for the translocation of the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, OppBC subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic composition and function of the Dpp transport system in Bacillus subtilis?

In Bacillus subtilis, the Dpp (dipeptide permease) system is one of three high-affinity ATP-binding cassette (ABC) peptide transporters that function with complementary specificities. The Dpp system primarily handles short substrates, with a particular affinity for dipeptides, while other systems like Opp cover intermediate-length peptides and App handles longer peptides. The complete Dpp system consists of multiple components, including the substrate-binding protein DppE, the permease proteins (including DppC), and ATP-binding proteins .

The Dpp system plays a crucial role in nutrient scavenging during vegetative growth, as evidenced by its regulation by the transcription factor CodY, which represses genes required under nutrient limitation conditions. This regulation mechanism suggests the Dpp system's importance in environmental adaptation .

How does DppC function within the broader Dpp transport system?

By comparing with the well-characterized DppC in Escherichia coli, we can understand that DppC in B. subtilis likely functions as a permease component of the ABC transporter. The permease proteins form a channel through the cell membrane that facilitates the translocation of dipeptide substrates from the periplasmic space into the cytoplasm. DppC works in conjunction with other components of the Dpp system - the substrate-binding protein (DppE) recognizes and binds dipeptides in the periplasmic space, while the ATP-binding proteins provide energy for the transport process through ATP hydrolysis .

In E. coli, DppC is part of the DppABCDF transporter complex involved in dipeptide transport and is responsible for the translocation of the substrate across the membrane. Similar functional architecture likely exists in B. subtilis, though with species-specific adaptations .

What strategies are most effective for cloning and expressing recombinant B. subtilis DppC?

For successful expression of recombinant B. subtilis DppC, researchers should consider the following methodology:

  • Gene amplification: Design primers that accurately capture the dppC coding sequence, considering codon optimization for the expression host.

  • Expression vector selection: For membrane proteins like DppC, vectors with tunable expression levels are preferred to prevent protein aggregation and toxicity.

  • Expression host: While E. coli is commonly used, homologous expression in B. subtilis may be advantageous for proper folding and insertion into the membrane.

  • Expression conditions: Optimize temperature, induction conditions, and duration to maximize yield while maintaining protein functionality. Lower temperatures (16-25°C) often improve membrane protein folding.

  • Fusion tags: Consider fusion tags like His6, FLAG, or MBP to facilitate purification and detection. For structural studies, TEV or 3C protease cleavage sites can be incorporated for tag removal.

Drawing from approaches used with similar proteins like DppE, truncated constructs may be necessary to remove signal peptides and lipidation sites for soluble expression, while maintaining core functional domains .

What purification methods are most suitable for recombinant DppC from B. subtilis?

Purification of membrane proteins like DppC requires specialized approaches:

Membrane Extraction Protocol:

  • Cell disruption via sonication or French press in a buffer containing protease inhibitors

  • Differential centrifugation to isolate membrane fractions

  • Membrane solubilization using detergents such as DDM, LDAO, or Triton X-100

  • Affinity chromatography utilizing fusion tags

  • Size exclusion chromatography for final purification and buffer exchange

Drawing from successful approaches with similar membrane proteins, researchers should optimize detergent concentration to effectively solubilize DppC while maintaining its native conformation. Stability assessment using methods like circular dichroism (CD) is recommended to ensure the purified protein retains its secondary structure throughout the purification process .

How does the structure of DppC relate to its transport function?

While no direct structural information for B. subtilis DppC is available in the provided search results, structural insights can be inferred from related components like DppE and from homologous systems.

The permease components of ABC transporters typically consist of multiple transmembrane helices that form a substrate translocation pathway across the membrane. The arrangement of these helices creates a pore with specificity determinants that enable selective transport of dipeptides.

The structure likely undergoes conformational changes during the transport cycle, alternating between inward-facing and outward-facing states to facilitate substrate movement across the membrane. These conformational changes are coupled to ATP binding and hydrolysis by the nucleotide-binding domains of the transporter complex.

Given that the homologous DppE protein exhibits specificity for cell wall peptides, it is reasonable to infer that the DppC permease component has evolved structural features that complement this specificity, potentially with binding sites that recognize specific chemical moieties of the transported dipeptides .

What experimental approaches can resolve potential structural contradictions in DppC models?

Resolving structural contradictions in DppC models requires a multi-method approach:

Comparative Methodology Table:

TechniqueAdvantagesLimitationsData Resolution
X-ray CrystallographyHigh resolution (1-3Å)Difficult for membrane proteinsAtomic-level detail
Cryo-EMWorks for membrane proteins without crystallizationMedium resolution for smaller proteins3-4Å resolution possible
NMR SpectroscopyDynamic informationSize limitationsResidue-specific interactions
Crosslinking Mass SpectrometryIdentifies interaction pointsIndirect structural informationResidue-pair distances
Molecular DynamicsSimulates conformational changesRelies on initial modelsNanosecond timescale dynamics

When conflicting structural models arise, researchers should:

  • Validate models against biochemical data (mutagenesis, substrate binding assays)

  • Test predictions from each model with targeted experiments

  • Consider protein dynamics rather than static structures

  • Use evolutionary conservation analysis to identify functionally important regions

  • Incorporate lipid environment effects in structural analysis

As demonstrated in the structural studies of DppE, combining multiple approaches provides more robust structural understanding than relying on a single method .

How is the dpp operon regulated in B. subtilis and what factors influence dppC expression?

The dpp operon in B. subtilis is under sophisticated regulatory control, with the transcription factor CodY playing a central role. CodY functions as a repressor during nutrient-rich conditions and responds to two signals: branched-chain amino acids and GTP. When these metabolites are abundant, CodY binds to the dpp promoter region and represses transcription. As nutrient availability decreases, particularly during the transition to stationary phase, CodY repression is relieved, allowing dpp expression .

This regulatory mechanism positions the Dpp system as a nutrient scavenging system that becomes activated when preferred nitrogen sources become limited. The expression of dppC, as part of the dpp operon, follows this regulatory pattern, ensuring that the transporter is produced when needed for nutrient acquisition.

Additional layers of regulation may include:

  • Response to cell wall stress

  • Sporulation-specific regulation

  • Potential cross-regulation with other peptide transport systems

Understanding these regulatory mechanisms is essential for designing expression systems for recombinant DppC production and for interpreting phenotypes in experimental studies .

What methodological approaches provide the most accurate assessment of dppC expression levels?

For accurate quantification of dppC expression levels, researchers should employ multiple complementary techniques:

Expression Analysis Approaches:

  • RT-qPCR: Provides sensitive measurement of mRNA levels with appropriate reference gene normalization. For dppC, normalization to stable reference genes such as rpoB or gyrA is recommended.

  • Reporter fusions: Transcriptional or translational fusions (e.g., lacZ, gfp) can provide spatial and temporal resolution of expression patterns under different conditions.

  • Proteomics: Targeted MS/MS approaches with isotope-labeled peptide standards enable absolute quantification of DppC protein levels in membrane fractions.

  • Western blotting: Using specific antibodies or epitope tags for immunodetection with appropriate membrane protein extraction methods.

  • RNA-Seq: Provides genome-wide context for dppC expression relative to other genes and operons.

When designing experiments to measure dppC expression, researchers should:

  • Include multiple time points to capture expression dynamics

  • Compare multiple growth conditions (especially nutrient availability variants)

  • Consider the membrane-bound nature of DppC in sample preparation

  • Account for potential post-transcriptional regulation

For time-course experiments, sampling intervals of 30-60 minutes during growth phases are typically sufficient to capture expression dynamics in response to changing nutrient conditions .

What methodologies are most effective for determining the substrate specificity of recombinant DppC?

Determining substrate specificity of recombinant DppC requires multiple complementary approaches:

In Vivo Transport Assays:

  • Construct dppC deletion mutants and complemented strains

  • Use radiolabeled or fluorescently-labeled dipeptides to track transport

  • Measure uptake kinetics (Km, Vmax) for various dipeptide substrates

  • Compare transport rates in wild-type versus mutant strains

In Vitro Reconstitution:

  • Purify DppC and reconstitute it with other Dpp components in proteoliposomes

  • Establish an in vitro transport assay with purified components

  • Test a range of potential substrates to define specificity parameters

Competition Assays:
Determine substrate preferences by measuring inhibition of labeled substrate transport by unlabeled competitors. This allows ranking of substrates by affinity.

Binding Studies:
While DppC itself may not directly bind substrates, its interaction with substrate-bound DppE can be studied using:

  • Surface plasmon resonance

  • Isothermal titration calorimetry

  • Fluorescence anisotropy

Studies with DppE have shown its preference for cell wall peptides containing meso-diaminopimelic acid, suggesting that the DppABCDF system in B. subtilis may be specialized for recycling cell wall components. Using similar methodological approaches for DppC characterization would help clarify its role in this process .

How can researchers distinguish between direct effects of DppC mutations and indirect effects on the Dpp transport system?

Distinguishing direct from indirect effects of DppC mutations requires a systematic approach:

  • Site-directed mutagenesis strategy: Create a panel of mutations including:

    • Conserved residues in transmembrane domains

    • Residues at predicted substrate-interaction sites

    • Interface residues with other Dpp components

    • Control mutations in non-conserved regions

  • Functional complementation: Test whether mutant variants can restore dipeptide transport in a dppC deletion strain

  • Protein expression verification: Confirm that mutations don't simply reduce protein expression or membrane insertion using Western blotting or fluorescent tagging

  • Assembly assays: Determine if DppC mutations affect complex formation with other Dpp components using:

    • Co-immunoprecipitation

    • Bacterial two-hybrid assays

    • FRET between tagged components

  • In vitro reconstitution: Compare activity of purified wild-type and mutant DppC proteins in reconstituted systems

  • Biophysical characterization: Assess whether mutations alter protein folding or stability using:

    • Circular dichroism spectroscopy to monitor secondary structure

    • Thermal shift assays to assess stability

    • Limited proteolysis to probe conformational changes

By systematically applying these approaches, researchers can differentiate between mutations that directly impact DppC function versus those that indirectly affect transport through altered expression, stability, or complex assembly .

How does B. subtilis DppC compare structurally and functionally to homologs in other bacterial species?

While detailed structural data for B. subtilis DppC is not directly provided in the search results, comparative analysis with other bacterial species can provide valuable insights:

Comparative Analysis Table of DppC Across Bacterial Species:

CharacteristicB. subtilis DppCE. coli DppCOther Gram-positive Species
Membrane topologyPredicted multiple transmembrane domainsMultiple transmembrane domainsSimilar topology expected
Substrate rangeLikely specialized for cell wall peptidesDipeptides and heme when foreign receptors presentSpecies-specific adaptations
System componentsPart of DppABCDF systemPart of DppABCDF systemGenerally conserved architecture
RegulationCodY-regulatedDifferent regulatory mechanismsVariable regulatory networks
Functional roleNutrient scavenging, potential cell wall recyclingDipeptide transport, alternative functionsOften specialized for ecological niche

The E. coli DppC functions in the ABC transporter DppABCDF involved in dipeptide transport, responsible for substrate translocation across the membrane. When foreign outer membrane heme receptors are expressed, this system can also transport heme and its precursor, 5-aminolevulinic acid (ALA) .

B. subtilis DppC likely shares the core translocation function but with adaptations reflecting the different cell envelope structure of Gram-positive bacteria and potentially specialized for cell wall peptide recycling, as suggested by the binding specificity of DppE .

Genome analysis using tools like the SEED viewer can identify gene clusters homologous to the B. subtilis dpp region, enabling broader evolutionary comparisons .

What experimental approaches can resolve contradictory findings about DppC function across different studies?

Resolving contradictory findings about DppC function requires systematic investigation:

  • Standardized experimental conditions: Create a standardized protocol that includes:

    • Defined growth media and conditions

    • Consistent genetic backgrounds

    • Standardized measurement methods

    • Validated reference strains

  • Direct comparison studies: Have multiple laboratories test identical strains and conditions to identify sources of variability

  • Genetic context evaluation: Determine if differences in results stem from:

    • Different strain backgrounds

    • Polar effects of mutations

    • Compensatory mutations

    • Differences in genetic constructs

  • Environmental variables testing: Systematically vary parameters that might influence results:

    • Growth phase

    • Media composition

    • Oxygen availability

    • Cell density

  • Multiomics approach: Integrate multiple data types:

    • Transcriptomics to assess expression levels

    • Proteomics to confirm protein production

    • Metabolomics to track substrate utilization

    • Phenomics to characterize growth under various conditions

  • Meta-analysis: Formally analyze previous studies to identify patterns in contradictory results and variables that may explain differences

When contradictions arise, using a pre-post-control (PPC) experimental design can be particularly valuable, as it allows researchers to monitor changes before and after interventions while controlling for confounding variables. This approach has been shown to provide more accurate effect size estimates in experimental studies .

How can recombinant DppC be utilized as a research tool for studying bacterial peptide transport systems?

Recombinant DppC can serve as a valuable research tool in several capacities:

  • In vitro reconstitution systems: Purified recombinant DppC, combined with other Dpp components, can be used to create defined proteoliposome systems for studying transport mechanisms under controlled conditions. This approach allows precise manipulation of protein components, substrates, and membrane composition.

  • Structural template: While no direct structural data for B. subtilis DppC is provided in the search results, recombinant DppC could be used for structural studies, providing templates for modeling other bacterial peptide transporters.

  • Protein-protein interaction studies: Tagged recombinant DppC can be used to identify interaction partners beyond the known Dpp components, potentially revealing new regulatory proteins or auxiliary factors that modulate transport activity.

  • Substrate screening platforms: Systems expressing recombinant DppC can be developed as screening tools to identify novel substrates or inhibitors of dipeptide transport, which could have implications for antimicrobial development.

  • Biosensor development: By coupling substrate transport to reporter systems, recombinant DppC-based biosensors could be developed for detecting specific dipeptides in environmental or clinical samples.

These applications leverage the specificity of the Dpp system for dipeptides and potentially cell wall components, as suggested by the binding characteristics of DppE in B. subtilis .

What are the critical methodological considerations for utilizing DppC in experimental vaccine vector systems?

When considering B. subtilis DppC in experimental vaccine vector systems, researchers should address these critical methodological aspects:

  • Expression optimization:

    • Codon optimization for stable expression

    • Promoter selection for appropriate expression timing

    • Signal sequence engineering for proper cellular localization

  • Antigen presentation strategies:

    • Direct fusion vs. co-expression approaches

    • Optimal epitope positioning to maintain both DppC function and antigen accessibility

    • Consideration of multiple epitope presentation strategies

  • Stability and safety assessment:

    • Genetic stability over multiple generations

    • Absence of antibiotic resistance markers in final constructs

    • Thorough safety profiling in animal models

  • Immunological evaluation protocol:

    • Comprehensive immune response characterization (humoral and cellular)

    • Comparison with established adjuvants and delivery systems

    • Long-term immunity studies

  • Delivery route optimization:

    • Mucosal vs. parenteral administration

    • Dosing schedule determination

    • Formulation for stability

The recent work with recombinant B. subtilis expressing PCV2d Cap protein demonstrates the potential of B. subtilis as a vaccine vector platform, though specific information about DppC in this context is not directly provided in the search results . The principles applied in that system could be adapted for DppC-based approaches, particularly leveraging B. subtilis' GRAS (Generally Recognized As Safe) status and ability to function as both production host and delivery vehicle.

What strategies can address expression and purification challenges with recombinant B. subtilis DppC?

Membrane proteins like DppC present substantial challenges in recombinant expression and purification. Based on approaches used with related proteins, researchers should consider:

Expression Troubleshooting:

  • Toxicity issues: Use tightly regulated inducible promoters (like IPTG-inducible systems with low basal expression) and consider lower induction temperatures (16-20°C).

  • Inclusion body formation: Optimize induction conditions (lower inducer concentration, reduced temperature, slower induction) or explore fusion partners known to enhance solubility (MBP, SUMO, TrxA).

  • Low expression levels: Test different host strains optimized for membrane protein expression (like C41/C43 for E. coli) or consider homologous expression in B. subtilis.

  • Improper membrane insertion: Include proper signal sequences and verify membrane localization using fractionation techniques followed by Western blotting.

Purification Solutions:

  • Detergent screening: Systematically test multiple detergents (DDM, LDAO, Fos-choline, etc.) for optimal extraction efficiency and protein stability.

  • Protein instability: Include stabilizing additives (glycerol, specific lipids, substrate analogs) in all buffers.

  • Aggregation during concentration: Use spin filters with appropriate molecular weight cutoffs and include suitable detergent concentrations above CMC.

  • Purity assessment: Employ multiple techniques (SDS-PAGE, size exclusion chromatography, mass spectrometry) to confirm sample homogeneity.

Similar approaches were successfully used in the structural studies of OppA and DppE from B. subtilis, where truncated constructs were designed to remove signal peptides and membrane anchoring regions while maintaining core functional domains .

How can researchers troubleshoot inconsistent results in DppC functional assays?

When facing inconsistent results in DppC functional assays, researchers should implement a systematic troubleshooting approach:

  • Sample preparation variability:

    • Standardize membrane preparation protocols

    • Validate protein quality before each assay

    • Prepare larger batches of reagents to minimize preparation differences

  • Assay condition optimization:

    • Create a detailed assay parameter matrix testing:

      • pH range (typically 6.5-8.0)

      • Buffer composition

      • Divalent cation concentrations

      • Temperature stability

    • Determine optimal detergent:lipid ratios for in vitro systems

  • Component integrity verification:

    • Assess ATP hydrolysis activity independently

    • Verify substrate binding by DppE or equivalent components

    • Confirm complex formation between system components

  • Data analysis standardization:

    • Implement consistent baseline correction methods

    • Use appropriate curve fitting models

    • Apply statistical tests to determine significance of differences

  • Experimental design enhancements:

    • Include positive and negative controls in each experiment

    • Perform technical and biological replicates

    • Consider using the pre-post-control (PPC) design when appropriate

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.