Recombinant Bacillus subtilis Disulfide bond formation protein C (bdbC)

Shipped with Ice Packs

In Stock

Cat. No.

BT2120533

Source

in vitro E.coli expression system

Synonyms

bdbC; yvgU; BSU33470; Disulfide bond formation protein C; Disulfide oxidoreductase C; Thiol-disulfide oxidoreductase C

Quick Inquiry

Description

Enzymatic Mechanism and Redox Partners

BdbC operates in tandem with BdbD (a DsbA homolog) to catalyze disulfide bond formation:

Oxidation Cycle:
- BdbD introduces disulfide bonds into substrate proteins (e.g., PhoA, ComGC) .
- Reduced BdbD is reoxidized by BdbC, which transfers electrons to membrane quinones .
Redox Potential:
- The BdbC-BdbD system has a midpoint reduction potential of −75 mV (similar to E. coli DsbA-DsbB) .

Suppression of CcdA Deficiency

BdbC mutations restore cytochrome c synthesis and sporulation in B. subtilis strains lacking CcdA, a thiol-reducing membrane protein .
This suppression highlights BdbC’s role in maintaining redox balance during post-translational modifications .

Secretion Stress Mitigation

BdbC is essential for limiting secretion stress caused by disulfide bond-containing proteins like PhoA .
Example: bdbC mutants exhibit upregulated stress-response pathways (e.g., HtrA, HtrB proteases) .

Competence Development

Inactivation of bdbC abolishes genetic transformability by reducing ComGC stability, a competence protein requiring disulfide bonds .

Functional Role	*Phenotype in bdbC* Mutants**	Reference
Cytochrome c maturation	Restored in CcdA-deficient strains
PhoA secretion efficiency	Reduced activity and stability
Competence development	Loss of transformability
Secretion stress response	Elevated HtrA/HtrB protease expression

Recombinant Protein Production

PhoA Case Study: Co-expression of BdbC/BdbD enables B. subtilis to secrete active E. coli PhoA, which requires two disulfide bonds .
Yield Optimization: Overexpression of bdbC enhances oxidative folding capacity, improving yields of disulfide-bonded therapeutics (e.g., antibodies, cytokines) .

Industrial Relevance

Advantages:
- GRAS (Generally Recognized As Safe) status of B. subtilis .
- Compatibility with high-density fermentation and secretion systems .

Challenges and Future Directions

Secretion Bottlenecks: Misfolded proteins in bdbC mutants accumulate, triggering stress responses that reduce yields .
Engineering Strategies:
- Promoter optimization (e.g., P $_{hag}$ , P $_{aprE}$ ) to fine-tune bdbC expression .
- Fusion tags (e.g., SacB signal peptide) to direct substrates to BdbC-dependent pathways .

Product Specs

Form

Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference when placing your order, and we will prepare the product accordingly.

Lead Time

Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for precise delivery timeframes.
Note: All our proteins are shipped standard with normal blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Reconstitution

We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.

Shelf Life

The shelf life of this product is influenced by various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Storage Condition

Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production. If you have a specific tag type in mind, please let us know, and we will prioritize its development.

Synonyms

bdbC; yvgU; BSU33470; Disulfide bond formation protein C; Disulfide oxidoreductase C; Thiol-disulfide oxidoreductase C

Buffer Before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Datasheet

Please contact us to get it.

Expression Region

1-138

Protein Length

full length protein

Species

Bacillus subtilis (strain 168)

Target Names

bdbC

Target Protein Sequence

MKNRIVFLYASWVVALIAMLGSLYFSEIRKFIPCELCWYQRILMYPLVLILGIATFQGDT RVKKYVLPMAIIGAFISIMHYLEQKVPGFSGIKPCVSGVPCSGQYINWFGFITIPFLALI AFILIIIFMCLLKGEKSE

Uniprot No.

O32217

Target Background

Function

This protein is essential for the stabilization, possibly via disulfide bond formation, of the obligatory competence protein ComGC. While not typically required for the production of the secreted lantibiotic sublancin 168, it can partially substitute for BdbB in its absence. It may also contribute to the stability of other secreted proteins. However, it is not required for sporulation.

Database Links

KEGG: bsu:BSU33470

STRING: 224308.Bsubs1_010100018171

Protein Families

DsbB family, BdbC subfamily

Subcellular Location

Cell membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

Recombinant Bacillus subtilis Disulfide bond formation protein C (bdbC)

Description

Enzymatic Mechanism and Redox Partners

Suppression of CcdA Deficiency

Secretion Stress Mitigation

Competence Development

Recombinant Protein Production

Industrial Relevance

Challenges and Future Directions

Product Specs

Target Background

Quick Inquiry

Category

Service