Recombinant Bacillus subtilis DNA translocase SpoIIIE (spoIIIE)

Shipped with Ice Packs
In Stock

Description

Molecular Mechanism of DNA Translocation

SpoIIIE operates as a directional DNA pump through the following steps:

  • Localization: The N-terminal domain targets SpoIIIE to the sporulation septum, forming a complex at the leading edge of the closing septum .

  • DNA Engagement: Hexameric SpoIIIE binds double-stranded DNA indiscriminately, with ATP hydrolysis fueling translocation .

  • Directionality: SpoIIIE recognizes SRS motifs (GAGAAGGG) skewed toward the dif site, ensuring unidirectional DNA transfer into the forespore .

  • Protein Stripping: During translocation, SpoIIIE displaces DNA-bound proteins (e.g., RNA polymerase, transcription factors), leaving the chromosome "naked" upon entry into the forespore .

This process is regulated by MinCD, which inhibits SpoIIIE assembly in the forespore to prevent reversed DNA transfer .

Role in Sporulation

During B. subtilis sporulation:

  • SpoIIIE translocates ~70% of the chromosome (origin-distal region) into the forespore through the closing septum .

  • Mutants lacking SpoIIIE fail to transfer DNA, resulting in a single terminus (ter) focus and anucleate forespores .

  • SpoIIIE also mediates membrane fusion post-engulfment, ensuring cytoplasmic compartmentalization .

Synergy with SftA in Vegetative Growth

SpoIIIE collaborates with the soluble DNA translocase SftA to resolve chromosome dimers:

  • SftA positions dif sites for dimer resolution by XerCD recombinases.

  • SpoIIIE resolves delayed segregation post-septation .

  • Double sftA spoIIIE mutants exhibit severe chromosome segregation defects, underscoring their overlapping roles .

Experimental Models and Functional Assays

Model SystemKey FindingsMethodologyReference
spoIIIE mutantsFailed DNA transfer into forespore; single ter focus observedFluorescence microscopy ( )
In vitro motilityATP-dependent translocation at 4–17 kb/s; SRS-guided directionalitySingle-molecule imaging ( )
MinCD deletionReversed DNA transfer into mother cell; anucleate foresporesGenetic and cytological analysis ( )
FRAP assaysSpoIIIE maintains septal integrity during membrane fusionPhotobleaching ( )

Applications and Implications

SpoIIIE’s ability to strip proteins from DNA and translocate chromosomes has broad implications:

  • Biotechnology: Engineered SpoIIIE variants could enhance DNA packaging in synthetic biology applications.

  • Antimicrobial Targets: Disrupting SpoIIIE-mediated DNA transfer could prevent sporulation in pathogenic Bacillus species.

  • Evolutionary Conservation: Homologs in diverse bacteria (e.g., FtsK in E. coli) suggest conserved mechanisms for DNA segregation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please include your requirement in the order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
spoIIIE; ftsK; BSU16800; DNA translocase SpoIIIE; Stage III sporulation protein E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-787
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
spoIIIE
Target Protein Sequence
MAKKKRKSRKKQAKQLNIKYELNGLLCIAISIIAILQLGVVGQTFIYLFRFFAGEWFILC LLGLLVLGVSLFWKKKTPSLLTRRKAGLYCIIASILLLSHVQLFKNLTHKGSIESASVVR NTWELFLMDMNGSSASPDLGGGMIGALLFAASHFLFASTGSQIMAIVMILIGMILVTGRS LQETLKKWMSPIGRFIKEQWLAFIDDMKSFKSNMQSSKKTKAPSKKQKPARKKQQMEPEP PDEEGDYETVSPLIHSEPIISSFSDRNEEEESPVIEKRAEPVSKPLQDIQPETGDQETVS APPMTFTELENKDYEMPSLDLLADPKHTGQQADKKNIYENARKLERTFQSFGVKAKVTQV HLGPAVTKYEVYPDVGVKVSKIVNLSDDLALALAAKDIRIEAPIPGKSAIGIEVPNAEVA MVSLKEVLESKLNDRPDAKLLIGLGRNISGEAVLAELNKMPHLLVAGATGSGKSVCVNGI ITSILMRAKPHEVKMMMIDPKMVELNVYNGIPHLLAPVVTDPKKASQALKKVVNEMERRY ELFSHTGTRNIEGYNDYIKRANNEEGAKQPELPYIVVIVDELADLMMVASSDVEDSITRL SQMARAAGIHLIIATQRPSVDVITGVIKANIPSRIAFSVSSQTDSRTILDMGGAEKLLGR GDMLFLPVGANKPVRVQGAFLSDDEVEKVVDHVITQQKAQYQEEMIPEETTETHSEVTDE LYDEAVELIVGMQTASVSMLQRRFRIGYTRAARLIDAMEERGVVGPYEGSKPREVLLSKE KYDELSS
Uniprot No.

Target Background

Function
SpoIIIE plays a critical role during sporulation. It is essential for the translocation of chromosomal DNA from the mother cell into the forespore during polar septation. This process is crucial for the final steps of compartmentalization in the presence of trapped DNA and for the final stages of engulfment. The N-terminus of SpoIIIE mediates localization to the division septum and is required for both septal membrane fusion and engulfment membrane fusion. It may form DNA-conducting channels across the two lipid bilayers of the septum after cell division. The C-terminus functions as a DNA motor that exports DNA in an ATP-dependent manner from the mother cell into the forespore. During translocation, DNA-binding proteins are removed from the chromosome, potentially playing a key role in reprogramming developmental gene expression in the forespore. The two arms of the chromosome are simultaneously pumped into the forespore, suggesting the presence of at least two channels in the septum, one for each arm. SpoIIIE is necessary for the separation of chromosome termini. It also contributes to optimal chromosome partitioning in vegetative cells by actively moving chromosomal DNA trapped within the division septum into the daughter cells.
Gene References Into Functions
  1. SpoIIIE assembles a coaxially paired channel for each chromosome arm, composed of one hexamer in each cell, to maintain membrane fission during DNA translocation. PMID: 25950186
  2. It has been established that SpoIIIE is required during spore formation for chromosome separation and translocation. Notably, SpoIIIE is not essential for separation during vegetative growth. PMID: 17322320
Database Links
Protein Families
FtsK/SpoIIIE/SftA family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Note=Localizes to the middle of the sporulation septum, then moves to the forespore pole before the completion of engulfment. Delocalizes after membrane fusion is complete. During sporulation, is exclusively assembled on the mother-cell side of the septum. During vegetative growth, assembles at the division septum when DNA is entrapped in the membranes.

Q&A

What is SpoIIIE and what is its primary function in Bacillus subtilis?

SpoIIIE is a 787 amino acid membrane-anchored DNA translocase in Bacillus subtilis that mediates chromosome translocation and membrane fission during sporulation . During sporulation, an asymmetrically-positioned septum creates a larger mother cell and smaller forespore. SpoIIIE localizes to the leading edge of the constricting septum and forms a stable focus at the septal midpoint . It performs two critical functions:

  • It maintains separation between mother cell and forespore septal membranes in the presence of a septum-trapped chromosome, playing an essential role in septal membrane fission .

  • It translocates approximately two-thirds of the chromosome length remaining in the mother cell into the forespore .

SpoIIIE essentially acts as a DNA pump that actively moves one of the replicated chromosomes into the prespore compartment .

How is SpoIIIE structurally organized?

SpoIIIE consists of two main functional domains:

  • N-terminal hydrophobic domain: Mediates localization to the division septum . Mutations in this domain can interfere with targeting to the septum and block DNA transfer .

  • C-terminal cytoplasmic domain: Functions as a DNA-dependent ATPase capable of tracking along DNA in the presence of ATP . This domain provides the motor activity necessary for DNA translocation.

The protein assembles into a complex architecture during sporulation:

SpoIIIE ArchitectureCharacteristics
Assembly patternCoaxially paired channel for each chromosome arm
CompositionOne hexamer in each cell (mother cell and forespore)
Distance between clustersApproximately 55 nm
Functional importanceMaintains membrane fission during DNA translocation

How does SpoIIIE's localization correlate with its function?

SpoIIIE's localization is tightly linked to its function:

  • Pre-septation: SpoIIIE is produced before polar septation occurs .

  • During septation: It localizes to the leading edge of the constricting septum .

  • Post-septation: As the sporulation septum closes around the chromosome, SpoIIIE forms a stable focus at the septal midpoint .

Immunofluorescence microscopy using affinity-purified anti-SpoIIIE antibodies has shown that SpoIIIE is targeted near the center of the asymmetric septum, supporting its direct role in transporting DNA through the septum . Proper localization is essential for function - mutations in the N-terminal hydrophobic domain that interfere with targeting to the septum also block DNA transfer .

What advanced microscopy techniques are most effective for visualizing SpoIIIE complexes?

Several advanced microscopy techniques have proven valuable for SpoIIIE visualization:

  • Quantitative Photoactivated Localization Microscopy (qPALM): This super-resolution approach allows visualization of SpoIIIE complexes in living cells with approximately 25 nm resolution. Researchers have employed qPALM in strains with a thickened sporulation septum to investigate the architecture and function of the SpoIIIE DNA translocation complex in vivo .

  • Immunofluorescence Microscopy: Using affinity-purified anti-SpoIIIE antibodies, researchers can visualize SpoIIIE localization at the septum .

  • Fluorescence Recovery After Photobleaching (FRAP): This technique has been used to demonstrate whether the sporulation septum remains open, allowing cytoplasmic contents to diffuse between daughter cells. FRAP experiments have revealed that some SpoIIIE mutants block membrane fusion after cytokinesis as well as after engulfment .

Methodological considerations:

  • When imaging live rather than fixed cells, researchers should be aware that movement of SpoIIIE during DNA translocation could overestimate the dimensions of the complex .

  • The spatial resolution of PALM (∼25 nm) remains significantly larger than the size of most macromolecular assemblies and larger than the distance between the two faces of the septum in wild-type cells (∼20 nm) .

How can cell-specific protein degradation be used to study SpoIIIE function?

Cell-specific protein degradation provides a powerful approach to determine the role of SpoIIIE in each cellular compartment:

Methodology:

  • Create strains with targeted degradation systems activated only in specific cellular compartments (mother cell or forespore).

  • Express SpoIIIE with appropriate degradation tags.

  • Induce degradation in one compartment while preserving SpoIIIE in the other.

  • Assess impact on DNA translocation and membrane fission.

Key findings using this approach:

  • Only the mother cell SpoIIIE complex is required to translocate DNA into the forespore, although DNA moves more efficiently when both complexes are present .

  • When SpoIIIE is present only in the forespore, DNA moved out of this cell and into the mother cell, demonstrating bi-directional capability .

  • Both the mother cell and forespore SpoIIIE complexes are required for maintaining membrane fission .

This technique helped researchers overcome limitations of conventional approaches by allowing selective removal of SpoIIIE from either daughter cell after division.

What experimental approaches can determine the molecular architecture of the SpoIIIE translocation complex?

Multiple complementary approaches can elucidate SpoIIIE's molecular architecture:

  • Genetic Engineering: Creating strains with thickened sporulation septa increases the distance between subcomplexes in each cell, facilitating their visualization and distinguishing between molecules in each cell .

  • Quantitative Super-Resolution Microscopy: qPALM combined with cell-specific protein degradation allows determination of the relative abundance of SpoIIIE in each daughter cell .

  • Biochemical Characterization: The C-terminal cytoplasmic part of SpoIIIE can be isolated and characterized as a DNA-dependent ATPase capable of tracking along DNA in the presence of ATP .

  • Mutational Analysis: Creating mutations in different domains and assessing their impact on localization and function. For example, mutations in the N-terminal hydrophobic domain can interfere with targeting to the septum and block DNA transfer .

The data support a model in which each chromosome arm is transported through a paired channel that spans two lipid bilayers, with one hexamer in each cell .

How does SpoIIIE achieve directional DNA translocation?

The directionality of SpoIIIE-mediated DNA translocation involves complex mechanisms:

  • SRS Recognition: Vectorial DNA translocation is dictated by the interaction of the γ domain of SpoIIIE with SpoIIIE recognition sequences (SRS) that are distributed in a skewed manner along the B. subtilis chromosome from the origin of replication towards the terminus .

  • Directional Models: Two primary models have been proposed:

    ModelMechanismEvidence
    Export ModelSpoIIIE exports DNA by selectively assembling motors in the mother cellSupported by cell-specific degradation showing mother cell complex is sufficient
    Import/ExportSpoIIIE can work bidirectionally depending on contextWhen only present in forespore, DNA moves out of forespore into mother cell
  • Experimental Findings: Cell-specific protein degradation experiments have shown that only the mother cell complex is required to translocate DNA into the forespore, whereas degradation in either cell reverses membrane fission . Furthermore, when SpoIIIE is present only in the forespore, DNA can move out of this cell and into the mother cell .

These findings suggest that SpoIIIE can operate, in principle, as a bidirectional motor, but the skewed distribution of SRS sequences likely enforces directionality during sporulation .

What is the relationship between SpoIIIE and chromosome dimer resolution systems?

SpoIIIE interacts with chromosome dimer resolution systems in a complex relationship:

  • Role in Partitioning: SpoIIIE is required for postseptational partitioning of chromosomes and serves as an important backup mechanism for partitioning when chromosomes fail to separate before septum formation .

  • Interaction with RipX: RipX (the B. subtilis homologue of E. coli XerD) acts in the terminus region to resolve chromosome dimers to monomers. SpoIIIE enhances the function of the RipX recombinase system, similar to how FtsK in E. coli facilitates XerCD function .

  • Genetic Interactions: The combination of spoIIIE mutations with other partitioning systems reveals complex relationships:

    • Deletion of spoIIIE causes a decrease in anucleate cells in ripX mutants

    • Deletion of spoIIIE enhances production of anucleate cells in rtp (replication termination protein) mutants

    • This apparent contradiction suggests SpoIIIE has dual functions: moving trapped chromosomes away from the division septum and facilitating RipX recombinase activity

  • Dependence on RecA: The increase in anucleate cells caused by combining rtp deletion with spoIIIE or ripX mutations depends on recA, indicating increased chromosome dimer formation in the absence of the replication termination system .

The interaction between SpoIIIE/FtsK-like proteins and Xer recombinases appears to be evolutionarily conserved, as genome analysis indicates that organisms with Xer homologues all have an FtsK homologue, and those without Xer homologues lack FtsK homologues .

How does SpoIIIE coordinate DNA translocation and membrane fission/fusion events?

SpoIIIE performs multiple functions that must be coordinated:

  • DNA Translocation: The C-terminal ATPase domain provides motor activity to pump DNA through the channel .

  • Membrane Fission: SpoIIIE keeps mother cell and forespore septal membranes separated in the presence of a septum-trapped chromosome .

  • Membrane Fusion: Some evidence suggests SpoIIIE may catalyze topologically opposite fusion events by assembling or disassembling a proteinaceous fusion pore .

Mutational studies provide insight into how these functions are coordinated:

  • Some SpoIIIE mutant proteins can initially localize normally and complete DNA translocation but show reduced membrane fusion after engulfment

  • FRAP experiments demonstrate that in these mutants, the sporulation septum remains open, allowing cytoplasmic contents to diffuse between daughter cells

  • The ability of SpoIIIE to provide a diffusion barrier is directly proportional to its ability to assemble a focus at the septal midpoint during DNA translocation

This suggests that SpoIIIE's ability to perform each function critically depends on its localization pattern (to the septum for DNA translocation and compartmentalization, to the pole for engulfment membrane fusion) .

How does SpoIIIE compare to FtsK and other DNA translocases?

SpoIIIE belongs to a family of DNA translocases with important similarities and differences:

FeatureSpoIIIE (B. subtilis)FtsK (E. coli)
LocationSporulation septumDivision septum
Primary roleChromosome translocation during sporulationChromosome segregation during division
StructureN-terminal membrane domain, C-terminal ATPaseN-terminal membrane domain, C-terminal ATPase
Recombinase interactionEnhances RipX functionRequired for efficient XerCD function
Directionality mechanismInteraction with SRS sequencesInteraction with KOPS sequences

The presence of SpoIIIE homologs in a broad range of bacteria suggests that this mechanism for active transport of DNA may be widespread . The C-terminal region of SpoIIIE is similar to the region of E. coli FtsK that is needed for XerCD function .

What methodological approaches are best for studying SpoIIIE interactions with other cellular systems?

To effectively study SpoIIIE interactions with other cellular systems:

  • Genetic Interaction Studies: Combine mutations in spoIIIE with mutations in other systems (e.g., ripX, rtp, recA) to identify synthetic phenotypes that reveal functional relationships .

  • Fluorescence Microscopy: Track multiple proteins simultaneously using different fluorescent tags to visualize potential co-localization or sequential recruitment .

  • Cell-Specific Protein Degradation: Selectively remove SpoIIIE from specific compartments to determine effects on other systems .

  • Biochemical Approaches: Investigate direct physical interactions between purified SpoIIIE domains and other proteins involved in chromosome segregation and cell division.

  • Subcellular Localization Studies: Determine the position of interacting proteins relative to SpoIIIE during different stages of sporulation or cell division .

Research has demonstrated, for example, that combining spoIIIE mutation with Δsmc causes a synthetic lethal phenotype, indicating important functional interactions between these chromosome organization systems .

What are common technical challenges in SpoIIIE research and how can they be addressed?

Researchers studying SpoIIIE face several technical challenges:

  • Resolution Limitations in Microscopy:

    • Challenge: The spatial resolution of PALM (∼25 nm) remains larger than the size of most macromolecular assemblies and the distance between septum faces in wild-type cells (∼20 nm) .

    • Solution: Use genetic tools like thick septum mutants to increase the distance between subcomplexes, making them more distinguishable .

  • Protein Movement During Imaging:

    • Challenge: Imaging live cells may overestimate complex dimensions if SpoIIIE moves during DNA translocation .

    • Solution: Use both fixed and live cell imaging, and compare results with caution.

  • Distinguishing Subcomplexes:

    • Challenge: Determining which SpoIIIE molecules belong to mother cell versus forespore complexes.

    • Solution: Combine super-resolution microscopy with cell-specific protein degradation to improve discrimination between molecules in each cell .

  • Functional Redundancy:

    • Challenge: SpoIIIE may have partially redundant functions with other proteins.

    • Solution: Use multiple mutation combinations and carefully designed assays that can detect partial defects.

How should researchers interpret contradictory results regarding SpoIIIE function?

When faced with contradictory results about SpoIIIE:

  • Consider Context-Dependent Functions: SpoIIIE may have different roles depending on growth conditions, genetic background, or cellular state. For example, SpoIIIE enhances anucleate cell production in rtp mutants but decreases it in ripX mutants .

  • Examine Multiple Functions: Contradictions may arise from focusing on different SpoIIIE functions. SpoIIIE has roles in DNA translocation, membrane fission, and potentially membrane fusion .

  • Strain Differences: Variations in experimental strains (e.g., thick septum vs. wild-type) may affect SpoIIIE behavior and should be considered when comparing results .

  • Quantitative vs. Qualitative Analysis: Some contradictions may be resolved by quantitative analysis. For example, cell-specific degradation experiments revealed that while the mother cell complex is sufficient for DNA translocation, having complexes in both cells improves efficiency .

  • Temporal Considerations: SpoIIIE may have different functions at different stages of sporulation or cell division. Carefully designed time-course experiments can help resolve apparent contradictions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.