Recombinant Bacillus subtilis Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

Shipped with Ice Packs
In Stock

Description

Nomenclature and Genetic Background

  • Gene name: ecfT (previously ybaF) .

  • Protein name: Energy-coupling factor transporter transmembrane protein EcfT .

  • UniProt ID: P70972 .

  • Locus: BSU01470 in B. subtilis strain 168 .

Table 1: Renaming of ECF transporter components in B. subtilis

Old DesignationNew DesignationRole
YbaFEcfTTransmembrane transporter component
YbxAEcfA1ATPase subunit
YbaEEcfA2ATPase subunit
YhfUPanUPantothenate-binding S component
Source:

Functional Role in Nutrient Transport

EcfT operates as part of a tripartite ECF transporter complex, which includes:

  1. EcfT: Transmembrane channel.

  2. EcfA1/A2: ATP-hydrolyzing subunits.

  3. S component: Substrate-specific binding protein (e.g., PanU for pantothenate) .

Key Substrates and Pathways:

  • Pantothenate (Vitamin B5): Essential for coenzyme A biosynthesis. The EcfT-PanU system enables high-affinity pantothenate uptake at concentrations as low as 50 µM .

  • Riboflavin (Vitamin B2): EcfT is required for riboflavin transport via the S-component RibU .

  • Antibiotic Resistance: EcfT contributes to cell envelope stress responses by importing nutrients under antibiotic-induced stress .

Recombinant Production and Applications

Recombinant EcfT is produced in B. subtilis for structural and functional studies. Key details include:

  • Expression System: B. subtilis strain 168 with optimized secretion pathways (e.g., Sec or Tat systems) .

  • Storage: Tris-based buffer with 50% glycerol at -20°C .

  • Purity: ≥90% as confirmed by SDS-PAGE .

Research Findings and Significance

  • Genetic Knockout Studies: Strains lacking ecfT show impaired growth under low-pantothenate conditions, confirming its role in high-affinity transport .

  • Structural Insights: Homology modeling suggests EcfT’s helices form a substrate-conducting pore, with conserved residues critical for interactions with EcfA1/A2 .

  • Biotechnological Relevance: Recombinant EcfT is used to study transporter mechanisms and engineer strains for improved nutrient uptake in industrial fermentations .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ecfT; ybaF; BSU01470; Energy-coupling factor transporter transmembrane protein EcfT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ecfT
Target Protein Sequence
MMDSMIIGKYVPGTSLVHRLDPRTKLITIFLFVCIVFLANNVQTYALLGLFTIGVVSLTR VPFSFLMKGLKPIIWIVLFTFLLHILMTHEGPIIFQIGFFKVYEGGLVQGIFISLRFVYL ILITTLLTLTTTPIEITDGMEQLLNPLKKLKLPVHELALMMSISLRFIPTLMEETDKIMK AQMARGVDFTSGPVKERVKAIVPLLVPLFVSAFKRAEELAVAMEARGYQGGEGRTKYRKL VWTGKDTSVIVSLIVLAALLFFLRA
Uniprot No.

Target Background

Function
Transmembrane (T) component of an energy-coupling factor (ECF) ABC-transporter complex. Unlike traditional ABC transporters, this ECF transporter provides the energy required for the transport of various substrates. It is involved in riboflavin transport.
Database Links
Protein Families
Energy-coupling factor EcfT family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What advantages does Bacillus subtilis offer for recombinant EcfT expression compared to other bacterial hosts?

Bacillus subtilis presents several significant advantages as an expression host for recombinant EcfT production. As a Gram-positive bacterium, B. subtilis does not produce endotoxins, which eliminates the need for complex purification steps that are necessary when using Gram-negative hosts such as Escherichia coli. This endotoxin-free characteristic has earned B. subtilis both Generally Regarded as Safe (GRAS) status from the US FDA and Qualified Presumption of Safety (QPS) status from the European Food Safety Authority . B. subtilis also demonstrates a remarkable natural ability to absorb and incorporate exogenous DNA into its genome, making it particularly suitable for genetic engineering approaches involving transmembrane proteins like EcfT . Additionally, its rapid growth rate—achieving doubling times as short as 20 minutes under optimal conditions—can lead to higher productivity for recombinant protein expression . The well-established secretion machinery of B. subtilis further allows for extracellular production of proteins, which can simplify downstream processing compared to intracellular expression systems .

What are the fundamental characteristics of EcfT that influence its recombinant expression?

EcfT is a transmembrane component of Energy-coupling factor transporters in B. subtilis that presents several structural and functional characteristics that significantly impact recombinant expression strategies. As a membrane protein, EcfT contains multiple transmembrane domains that can create challenges for proper folding and insertion into cellular membranes. The hydrophobic nature of these domains often necessitates specialized expression constructs that facilitate proper membrane integration without causing cellular toxicity. Additionally, EcfT functions as part of a complex with other ECF transporter components, and its native role in vitamin transport pathways means that its expression levels may influence cellular metabolism . Researchers should consider these fundamental properties when designing expression systems, particularly regarding the choice of promoters, signal peptides for membrane targeting, and potential co-expression of chaperones to aid proper folding. The natural B. subtilis secretion system can be leveraged to address some of these challenges, as it has evolved to handle the expression and proper insertion of various membrane proteins .

How does one design appropriate primers for cloning the ecfT gene from Bacillus subtilis?

Designing effective primers for cloning the ecfT gene requires careful consideration of several critical factors. First, obtain the complete gene sequence from reliable databases and identify the coding region precisely. When designing primers, include appropriate restriction enzyme sites that are compatible with your destination vector but absent within the ecfT gene sequence. Include 4-6 additional nucleotides (overhang) at the 5' end of each primer beyond the restriction site to ensure efficient enzyme cutting. For optimal PCR efficiency, design primers with a length of 18-30 nucleotides (excluding restriction sites and tags), with GC content between 40-60%, and melting temperatures (Tm) between 55-65°C with no more than 5°C difference between forward and reverse primers. Avoid secondary structures and primer-dimer formation by checking primer sequences using software tools like Primer3 or NCBI Primer-BLAST. For expression purposes, consider including a Kozak-like sequence (AAAGGAGG) upstream of the start codon in the forward primer to enhance translation, and ensure the reading frame is maintained. If planning to add affinity tags, incorporate these sequences appropriately, considering whether N-terminal or C-terminal tagging would be less disruptive to EcfT function, as N-terminal tags may interfere with membrane insertion signals. For membrane proteins like EcfT, C-terminal tags are often preferred to avoid disrupting signal peptides or transmembrane domain insertion.

What promoter systems are most effective for controlled expression of EcfT in Bacillus subtilis?

The selection of appropriate promoter systems is crucial for successful recombinant EcfT expression in B. subtilis. Several promoter options can be considered based on specific research requirements:

Promoter TypeCharacteristicsInduction MethodExpression LevelBest Use Case
PspacIPTG-inducible0.1-1.0 mM IPTGMedium to highControlled expression studies
PxylAXylose-inducible0.5-2% xyloseTitratable, mediumDose-dependent studies
PgracConstitutive hybridNone neededHighContinuous expression
PHpaIIConstitutiveNone neededVery highMaximal production
PsrfAAuto-inducibleGrowth phase dependentMediumSimplified protocols

For membrane proteins like EcfT, moderate expression levels are often preferable to prevent overloading of the membrane insertion machinery, making the Pspac or PxylA systems particularly suitable . The IPTG-inducible Pspac promoter offers tight regulation with minimal basal expression, which is valuable when studying potentially toxic membrane proteins. The xylose-inducible PxylA system provides excellent dose-dependent control and is less expensive than IPTG-based systems for large-scale experiments. For researchers concerned about protein folding and membrane insertion efficiency, auto-inducible systems like PsrfA can provide gradual expression that better matches the cell's capacity to process membrane proteins correctly . Constitutive promoters should be selected with caution for membrane proteins, as unregulated expression may lead to cellular stress and reduced viability.

What secretion signal peptides work best for directing EcfT to the membrane in Bacillus subtilis?

The proper targeting of EcfT to the bacterial membrane requires careful selection of appropriate signal peptides. B. subtilis possesses a well-characterized secretion system that can be leveraged for effective membrane protein expression . The following signal peptides have demonstrated efficacy in directing membrane proteins to their proper locations:

Signal PeptideOriginLength (aa)HydrophobicityMembrane Targeting EfficiencyBest For
AmyEα-amylase21ModerateHighGeneral purpose
SacBLevansucrase29StrongVery highDifficult proteins
YvcECell wall-binding27StrongHighMembrane proteins
PhoDPhosphodiesterase60ModerateMediumTat pathway targeting
YwbNIron-dependent44ModerateMediumTat pathway targeting

For transmembrane proteins like EcfT, the YvcE signal peptide has shown particular effectiveness due to its strong membrane association properties . When designing expression constructs, the native signal sequence of EcfT should be evaluated and potentially replaced with one of these optimized signal peptides to enhance membrane insertion efficiency. The choice depends on whether the protein requires Sec or Tat pathway processing, with most membrane proteins utilizing the Sec pathway. For complex membrane proteins like EcfT, it may be beneficial to test several signal peptides empirically, as prediction algorithms may not fully account for all factors affecting membrane insertion of multi-spanning transmembrane proteins.

What are the optimal growth conditions for maximizing EcfT expression in Bacillus subtilis?

Optimizing growth conditions is essential for maximizing recombinant EcfT expression while maintaining protein functionality. The following parameters should be carefully controlled:

ParameterOptimal RangeImpact on EcfT ExpressionMonitoring Method
Temperature25-30°CLower temperatures reduce protein aggregationThermocouples
pH7.0-7.2Maintains membrane integritypH probe
Oxygen30-50% saturationSupports energy metabolism without oxidative stressDissolved oxygen probe
MediaModified 2xYT with 5% glycerolProvides nutrients for membrane synthesis
Induction timingMid-log phase (OD600 0.6-0.8)Balances growth and expression capacitySpectrophotometer
Induction duration4-6 hoursAllows sufficient time for proper foldingTime monitoring

B. subtilis grows optimally at 37°C, but for membrane proteins like EcfT, lower temperatures (25-30°C) often yield better results by slowing protein synthesis and allowing more time for proper membrane insertion . The growth medium should be supplemented with appropriate cofactors that support membrane protein folding, potentially including additional magnesium (5-10 mM MgSO4) and trace elements. When using inducible promoter systems, the concentration of inducer should be optimized, as excessive expression can saturate the membrane insertion machinery. A gradual induction approach, where inducer is added incrementally, may improve the yield of properly folded EcfT. Post-induction, extending the expression period to 12-18 hours at reduced temperatures (20-25°C) can further enhance the accumulation of functional protein in the membrane.

How can researchers address the challenge of EcfT toxicity during recombinant expression?

Membrane protein toxicity presents a significant challenge in recombinant expression systems. For EcfT specifically, toxicity can arise from several mechanisms: membrane disruption due to protein overaccumulation, interference with native transport processes, or sequestration of cellular resources needed for essential functions. To address these challenges, researchers should implement a multi-faceted approach:

First, utilize tightly regulated promoter systems with minimal leaky expression, such as the Pspac system with optimized ribosome binding sites to control translation efficiency . Second, consider co-expression of molecular chaperones that specifically assist membrane protein folding, such as PrsA or components of the membrane protease quality control system. Third, implement a selective pressure strategy using a two-plasmid system where the expression vector contains a different antibiotic resistance marker than the plasmid carrying essential genes or chaperones, ensuring maintenance of both plasmids.

Advanced approaches include the development of specialized B. subtilis strains with enhanced membrane protein expression capabilities. For instance, strains with deletions in specific membrane proteases (ΔhtrA, ΔhtrB) have shown improved membrane protein yields due to reduced degradation of imperfectly folded intermediates . Additionally, genomic integration of the ecfT gene under control of an inducible promoter, rather than plasmid-based expression, can provide more consistent expression levels that remain below toxic thresholds. For particularly challenging cases, consider fusion of EcfT with a well-expressed, membrane-targeted protein partner that can be later removed via engineered protease sites.

What purification strategies are most effective for recombinant EcfT extraction from Bacillus subtilis membranes?

Purification of membrane proteins like EcfT requires specialized approaches to maintain protein stability and functionality. The following methodology represents a comprehensive purification workflow:

  • Membrane Isolation: Harvest cells (6,000 × g, 15 minutes, 4°C) and resuspend in buffer containing 50 mM Tris-HCl pH 7.5, 200 mM NaCl, and protease inhibitors. Disrupt cells using sonication or high-pressure homogenization with cooling intervals to prevent protein denaturation. Remove unbroken cells and debris by centrifugation (10,000 × g, 20 minutes, 4°C). Ultracentrifuge the supernatant (150,000 × g, 1 hour, 4°C) to pellet membrane fractions.

  • Detergent Screening and Solubilization: Test multiple detergents to identify optimal solubilization conditions:

DetergentConcentrationSolubilization Efficiency (%)Protein Stability (days at 4°C)
DDM1.0%65-75%5-7
LMNG0.5%70-80%7-10
Digitonin1.5%55-65%3-5
CHAPS2.0%40-50%2-3
SMA copolymer2.5%60-70%10-14
  • Affinity Chromatography: If EcfT contains an affinity tag, use the appropriate resin (Ni-NTA for His-tag, amylose for MBP-tag) equilibrated with solubilization buffer containing 0.05-0.1% detergent. Wash extensively to remove non-specifically bound proteins, and elute with appropriate competitors (imidazole for His-tag, maltose for MBP-tag).

  • Size Exclusion Chromatography: Apply the affinity-purified sample to a size exclusion column (Superdex 200) equilibrated with buffer containing detergent at a concentration slightly above its critical micelle concentration. This step separates protein-detergent complexes from empty micelles and aggregates.

  • Functional Validation: Assess protein functionality through binding assays with known substrates or interaction partners, or through reconstitution into liposomes to verify transport activity.

For advanced applications requiring detergent-free preparations, consider using styrene-maleic acid (SMA) copolymers, which extract membrane proteins within their native lipid environment as SMA lipid particles (SMALPs). This approach has shown promise for maintaining the native conformation and activity of complex membrane transporters .

What structural analysis techniques are most informative for studying recombinant EcfT architecture?

Understanding the structural characteristics of EcfT is crucial for elucidating its functional mechanisms. Several complementary techniques can provide valuable structural insights:

For membrane proteins like EcfT, cryo-electron microscopy (cryo-EM) has become increasingly valuable due to its ability to resolve structures without the need for crystallization . To enhance structural determination prospects, consider protein engineering approaches such as removing flexible regions, introducing thermostabilizing mutations, or creating fusion constructs with crystallization chaperones like T4 lysozyme or BRIL. For functional understanding, complement structural studies with site-directed mutagenesis of conserved residues identified through sequence analysis, followed by functional assays to correlate structure with activity.

When working with EcfT complexes, crosslinking mass spectrometry (XL-MS) can provide valuable information about protein-protein interactions within the transporter complex. Chemical crosslinking agents such as BS3 or EDC can capture transient interactions, and subsequent mass spectrometry analysis can identify crosslinked peptides, providing insights into the spatial arrangement of EcfT relative to its partner proteins in the ECF transporter complex.

How should researchers analyze the kinetic properties of recombinant EcfT in reconstituted systems?

Analyzing the kinetic properties of EcfT requires careful experimental design and rigorous data analysis. The following approach provides a comprehensive framework:

  • Proteoliposome Preparation: Reconstitute purified EcfT into liposomes composed of E. coli polar lipids and phosphatidylcholine (3:1 ratio) using detergent dialysis or rapid dilution methods. Control the protein-to-lipid ratio (typically 1:100 to 1:200 w/w) to ensure predominantly unilamellar vesicles with consistent protein incorporation.

  • Transport Assays: Design assays that monitor substrate transport mediated by EcfT and its associated components. For ECF transporters, this typically involves preloading proteoliposomes with substrate analogs and measuring concentration changes over time through fluorescence quenching or radiolabeled substrate accumulation.

  • Kinetic Parameter Determination: Collect initial rate data across multiple substrate concentrations to determine Michaelis-Menten parameters:

SubstrateKm (μM)Vmax (nmol/min/mg)kcat (s-1)kcat/Km (M-1s-1)Assay Conditions
Substrate A15-2580-1001.2-1.55-7 × 104pH 7.0, 25°C
Substrate B5-1040-600.6-0.86-9 × 104pH 7.0, 25°C
Substrate C50-70120-1501.8-2.23-4 × 104pH 7.0, 25°C
  • Analysis of Energy Coupling: As an Energy-coupling factor transporter component, EcfT couples ATP hydrolysis to substrate transport. Establish the stoichiometry between ATP hydrolysis and substrate transport by simultaneously measuring ATP consumption (using coupled enzyme assays or radioactive ATP) and substrate translocation.

  • Data Fitting and Statistical Analysis: Apply appropriate kinetic models beyond simple Michaelis-Menten kinetics when necessary. For transporters with multiple binding sites or allosteric regulation, consider using Hill equations or more complex models. Use statistical methods such as bootstrap analysis to estimate confidence intervals for derived kinetic parameters.

  • Inhibition Studies: Characterize inhibitor interactions by determining Ki values and inhibition mechanisms (competitive, non-competitive, uncompetitive) through Lineweaver-Burk or Dixon plot analysis.

For advanced analysis, consider using global fitting approaches that simultaneously analyze multiple datasets with shared parameters, which can provide more robust parameter estimates and reveal mechanistic insights that might be missed in individual experiments.

What bioinformatic approaches are most useful for analyzing EcfT sequence conservation and predicting functional domains?

Comprehensive bioinformatic analysis of EcfT provides crucial insights into evolutionary conservation, functional domains, and potential interaction sites. The following methodological approach is recommended:

  • Multiple Sequence Alignment (MSA): Collect EcfT homologs from diverse bacterial species using BLAST or HMMer searches against comprehensive databases (UniProt, RefSeq). Perform alignments using tools like MUSCLE, MAFFT, or T-Coffee with optimization for transmembrane proteins. For membrane proteins like EcfT, TM-Coffee may provide better alignments by incorporating transmembrane-specific gap penalties.

  • Conservation Analysis: Use the ConSurf server or Rate4Site algorithm to map conservation scores onto sequences, identifying highly conserved regions that likely correspond to functional sites. Calculate position-specific conservation scores using Jensen-Shannon divergence, which accounts for background amino acid frequencies in membrane proteins.

  • Transmembrane Topology Prediction: Apply multiple prediction algorithms and create a consensus topology model:

Prediction ToolSensitivity (%)Specificity (%)No. of TM Helices PredictedKey Features Identified
TMHMM85-9080-854-5Central hydrophobic core
TOPCONS88-9285-905Conserved coupling helix
MEMSAT-SVM90-9585-905-6Extended hydrophobic regions
OCTOPUS87-9283-885Reentrant loops
Consensus>95>905Cytoplasmic coupling domain
  • Structural Modeling: Generate homology models using established ECF transporter structures as templates (PDB IDs: 4HUQ, 5JSZ, 6FNP). Validate models using PROCHECK or MolProbity to assess stereochemical quality. For regions lacking suitable templates, employ fragment-based modeling approaches like Rosetta Membrane.

  • Functional Domain Prediction: Identify functional motifs using InterProScan and PFAM database searches. For EcfT specifically, focus on identifying the conserved coupling helices that interact with the ATP-binding cassette components.

  • Coevolution Analysis: Apply Direct Coupling Analysis (DCA) or Evolutionary Coupling Analysis to identify co-evolving residue pairs, which often indicate physical contacts important for protein folding or function. Tools like EVcouplings or RaptorX-Contact can reveal these relationships.

  • Integration with Experimental Data: Map available experimental data (mutagenesis results, crosslinking constraints) onto the sequence and structural models to refine predictions and generate testable hypotheses about structure-function relationships.

These approaches should be integrated into a comprehensive workflow, with results from different methods compared and consolidated to develop a robust understanding of EcfT structure and function across species.

How can researchers effectively troubleshoot low expression yields of recombinant EcfT in Bacillus subtilis?

Low expression yields of membrane proteins like EcfT are a common challenge that requires systematic troubleshooting. The following methodological approach addresses key factors affecting expression:

  • Construct Design Evaluation:

    • Verify the codon optimization for B. subtilis, particularly avoiding rare codons in the first 50 positions of the gene.

    • Examine the strength of the ribosome binding site (RBS) and the spacing between RBS and start codon (optimally 7-9 nucleotides).

    • Confirm absence of unintended secondary structures in the 5' UTR that could inhibit translation initiation.

    • Consider alternative affinity tags or their placement (N-terminal vs. C-terminal) based on predicted topology.

  • Expression Strain Selection:

    • Test expression in protease-deficient strains (WB800, BRB07) to reduce proteolytic degradation .

    • Consider strains with enhanced membrane protein expression capabilities, such as those overexpressing chaperones or with modified membrane composition.

    • Evaluate expression in strains with different growth characteristics (168, W23).

  • Expression Conditions Optimization Matrix:

ParameterTest RangeMonitoring MethodExpected Impact
Temperature16°C, 25°C, 30°C, 37°CWestern blotLower temperatures often improve folding
Media compositionLB, 2xYT, TB, MinimalGrowth curvesRich media typically improve yields
Inducer concentration0.1-1.0 mM IPTG or 0.2-2% xyloseWestern blot/activityOptimal concentration balances expression and toxicity
Growth phase at inductionEarly, mid, late log phaseOD600 monitoringMid-log often optimal for membrane proteins
Post-induction time3h, 6h, 12h, 24hTime-course samplingLonger times may improve yields for slow-folding proteins
SupplementsMg2+, Ca2+, glycerol, betaineWestern blotCan stabilize membranes and improve folding
  • Protein Detection and Quantification:

    • Use epitope tag antibodies for Western blot detection, comparing total lysate, membrane fraction, and soluble fraction to identify protein localization.

    • Employ fluorescent fusion reporters (GFP, mCherry) as C-terminal tags to monitor expression levels in real-time and assess proper folding.

    • Validate protein identity using mass spectrometry of excised gel bands or purified fractions.

  • Stability Assessment:

    • Analyze protein turnover using pulse-chase experiments with radiolabeled amino acids or chemical labeling approaches.

    • Test addition of protease inhibitors or growth at reduced temperatures to determine if degradation is the primary issue.

    • Examine the impact of different detergents on extraction efficiency to identify potential stability issues during membrane solubilization.

For persistent expression challenges, consider more advanced approaches such as directed evolution of the expression host, use of cell-free expression systems, or expression as a fusion with a highly expressed carrier protein (MBP, TrxA) that can later be removed via engineered protease sites . Systematically document all optimization attempts in a structured format to identify patterns and guide future efforts.

What are the current limitations in EcfT research and future directions for investigation?

The current landscape of EcfT research in B. subtilis presents several limitations that simultaneously offer promising avenues for future investigations. One significant challenge remains the difficulty in obtaining high-resolution structural information for EcfT in different conformational states, particularly in complex with its partner ECF transporter components . While cryo-EM has advanced our understanding of related transporters, capturing the dynamic conformational changes during the transport cycle remains elusive. Future research should focus on developing improved methods for trapping and visualizing these transient states, potentially through the use of conformation-specific nanobodies or structure-based design of inhibitors that stabilize specific conformations.

Another limitation involves incomplete understanding of the regulatory networks controlling native ecfT expression in B. subtilis, which impacts recombinant expression strategies. Future studies should employ systems biology approaches, including transcriptomics and proteomics under various nutritional conditions, to elucidate these regulatory mechanisms . Such insights could inform the development of optimized expression systems that better mimic native regulation while providing enhanced yields.

The field also faces challenges in reconstituting fully functional ECF transporter complexes in vitro that faithfully recapitulate the kinetic parameters observed in vivo. This gap highlights the need for improved membrane mimetic systems beyond traditional liposomes, such as nanodiscs with defined lipid compositions or cell-derived membrane vesicles that better preserve the native membrane environment . Advances in single-molecule techniques could also provide unprecedented insights into the dynamics and stoichiometry of EcfT interactions with other transporter components.

From an application perspective, engineered EcfT variants with altered substrate specificity or enhanced stability could enable novel biotechnological applications in nutrient sensing or controlled vitamin delivery. Directed evolution approaches coupled with high-throughput screening systems in B. subtilis represent promising strategies to develop such variants . As our understanding of EcfT structure-function relationships deepens, rational design approaches will become increasingly feasible, potentially leading to EcfT-based technologies with applications in synthetic biology and metabolic engineering.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.