Recombinant Bacillus subtilis Flagellar biosynthetic protein flhB (flhB)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Please note that we prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request as best as possible.
Please note that we prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional fees may apply.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is advisable to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
flhB; BSU16380; Flagellar biosynthetic protein FlhB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-360
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
flhB
Target Protein Sequence
MKLRVDLQFFAGEKTEKATPKKRKDTRKKGQVAKSSDVNTAVSLLVIFLSLIAIGPYMRD
RLLSFIETFYTESLTMKLSESNVHTLFVSLLKDMGMILAPILLVALVAGVVSNYMQVGFL
FSAEVIQPKLEKLDPIKGFKRIYSMRAIVELIKSILKIVVVGFAAFAVLWLHYGEILRLP
LLTPEEALSFVSKLTLWMGLSGAGALLILAGLDYLYQRFDYEKNIKMSKQDIKDEYKKSE
GDPIIKSKIKQRQREMAMRRMMQEVPKADVIITNPTHYAIALKYDEEKMDAPYIVAKGVD
HLALKIRKIAKEHDVMMVENRPLARALYDQVEIDQAVPEEFFKVLAEILAYVYKTKQKVY
Uniprot No.
Target Background
Function
May be involved in the export of flagellum proteins.
Database Links
KEGG: bsu:BSU16380
STRING: 224308.Bsubs1_010100009036
Protein Families
Type III secretion exporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
