Recombinant Bacillus subtilis Flagellar M-ring protein (fliF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
fliF; BSU16210; Flagellar M-ring protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-536
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
fliF
Target Protein Sequence
MNRTLMQMKNKTSEFWKNRSKLQKILMVSALAAIIIIGIIISVFASNSKMAPLYKDLSAE EAGQIKEELDAKKVPNELSNGGTVISVPEDQVDSLKVQMAAEGLPKTGSIDYSFFGQNAG FGLTDNEFDMVKVKATQTELSNLINEMDGIKNSKVMINLPKDAVFVGEEQSAASASIVLQ IQPGYTLDQSQINGLYHLVSKSVPNLKEDNIVIMDQNSTYYDKSDSDAGSYADSYSSQQG IKSQVEKDIQKHVQSLLGTMMGQDKVVVSVTADIDFTKENRTEDIVEPVDKENMEGIAVS AEKVSETYQGDGAANGGTAGTGEEDVTNYKADGENTESGNYEKNSNKINYEVNRIHKEIA ESPYKVRDLGIQVMVEPPDAKNTASLSTERQDDIQKILSTVVRTSLDKDETQNQNLSDAD INNKIVVSVQPFDGKVNLDTNTEESSGIPLWAYIVGGVLIAAIIVLIIMLIRKKRAQEDE FEEYEYEVPQEPINLPDINEEENETAESVRRKQLEKMAKDKPEDFAKLLRSWLAED
Uniprot No.

Target Background

Function

The M ring is believed to play an active role in energy transduction.

Database Links
Protein Families
FliF family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Bacterial flagellum basal body.

Q&A

What is the structural composition of the FliF protein in B. subtilis?

FliF consists of a transmembrane region with two helices anchoring it to the inner membrane and a periplasmic region containing three ring-building motifs (RBMs): RBM1, RBM2, and RBM3. These RBMs are structurally homologous to components found in other bacterial secretion systems. The periplasmic region forms the MS-ring structure, with the M-ring embedded in the membrane and the S-ring extending into the periplasm . Recent structural analyses have revealed that FliF adopts multiple symmetries within a single complex, displaying C11, C23, and C34 symmetries that likely serve different functional roles in flagellar assembly and rotation .

How does FliF interact with other flagellar proteins during assembly?

The MS-ring formed by FliF acts as a foundation for flagellar assembly, serving as a scaffold that recruits the C-ring through direct interactions with FliG. Additionally, FliF interacts with components of the export apparatus, facilitating the assembly of the complete flagellar structure . These interactions are critical for establishing proper flagellar architecture and function. FliF assembly occurs early in flagellar biogenesis, and its correct formation is essential for subsequent recruitment of other flagellar components .

What are the functional domains within FliF that contribute to oligomerization?

FliF contains multiple domains that contribute to its oligomerization and formation of the MS-ring structure. Experimental evidence indicates intricate interactions between these domains: RBM1 binds to RBM2 to prevent its oligomerization, while RBM3 counteracts this interaction . Research shows that RBM3 can induce oligomerization of the RBM1-RBM2 construct, suggesting a coordinated assembly mechanism. Negative stain electron microscopy reveals that mixing RBM3 with RBM1-RBM2 produces both ring-like structures (from RBM3 alone) and tubular structures likely composed of stacked RBM1-RBM2-RBM3 rings .

What expression systems are most effective for producing recombinant B. subtilis FliF?

For recombinant expression of B. subtilis FliF, E. coli BL21(DE3) has proven to be an effective host system, similar to successful approaches used for other bacterial flagellar proteins . The methodology involves cloning the fliF gene into an expression vector containing an affinity tag (typically His6 or GST) to facilitate downstream purification. Expression is typically induced with IPTG when cultures reach mid-log phase (OD600 of 0.6-0.8), followed by incubation at lower temperatures (16-25°C) to enhance protein solubility. This approach minimizes inclusion body formation while maintaining good protein yield.

What purification strategy yields the highest purity and stability for recombinant FliF?

The optimal purification strategy for recombinant FliF involves:

  • Initial clarification of cell lysates by high-speed centrifugation (20,000 × g for 30 minutes)

  • Affinity chromatography using Ni-NTA for His-tagged constructs

  • Ion exchange chromatography to remove contaminants

  • Size exclusion chromatography for final polishing and buffer exchange

For membrane-associated constructs containing the transmembrane domains, detergent solubilization is critical. A comparison of detergent effectiveness is presented in Table 1:

DetergentExtraction EfficiencyOligomeric State PreservationRecommended Concentration
DDMHighExcellent1% for extraction, 0.05% for purification
LMNGHighVery good0.5% for extraction, 0.01% for purification
Triton X-100ModeratePoorNot recommended
DigitoninModerateGood1% for extraction, 0.1% for purification

Buffer composition should include 50 mM Tris-HCl pH 8.0, 150-300 mM NaCl, and 5-10% glycerol to enhance protein stability during purification and storage.

How can researchers effectively analyze the oligomeric state of recombinant FliF?

Multiple complementary techniques should be employed to accurately determine the oligomeric state of recombinant FliF:

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) provides absolute molecular weight determination in solution

  • Analytical ultracentrifugation (AUC) offers information on sedimentation properties and can distinguish between different oligomeric species

  • Blue native PAGE allows visualization of intact protein complexes

  • Chemical crosslinking followed by mass spectrometry identifies specific interaction interfaces

For the most detailed structural information, negative-stain electron microscopy can directly visualize the ring-like structures formed by FliF, revealing important details about symmetry and organization . Advanced structural studies typically combine these approaches with cryoEM to achieve higher resolution.

What are the critical parameters for successful crystallization of FliF domains?

Crystallization of FliF domains is challenging due to their tendency to form higher-order oligomers. Successful approaches have involved:

  • Using truncated constructs focusing on specific domains (e.g., FliF D1-D2) rather than full-length protein

  • Employing detergent screening for constructs containing transmembrane regions

  • Testing multiple buffer conditions with varying salt concentrations (100-500 mM), pH ranges (6.5-8.5), and precipitants

  • Including additives that promote crystal contacts without disrupting native oligomerization

Temperature is a critical parameter, with most successful crystallization occurring at 18-20°C using the hanging drop vapor diffusion method. Protein concentration typically ranges from 5-15 mg/ml, depending on the specific construct.

How do researchers distinguish between the different symmetries present in the MS-ring?

The MS-ring displays a remarkable complexity with three distinct symmetries (C11, C23, and C34) . To distinguish between these symmetries:

  • CryoEM with 3D reconstruction is the primary method, allowing separate analysis of different regions:

    • Apply focused 3D classification to isolate substructures

    • Use symmetry-free reconstruction followed by symmetry analysis

    • Employ symmetry-restrained refinements with different symmetry parameters

  • Cross-linking mass spectrometry can identify specific interfaces that differ between symmetry components

  • Mutational analysis targeting residues at predicted interfaces between specific symmetry elements can provide functional validation

CryoEM studies have revealed that FliF adopts two distinct conformations in the M-ring relative to the rest of the protein, with 23 chains forming the wheel structure and 11 chains forming the cogs, while all 34 chains come together to form the S-ring with C34 symmetry .

What mechanisms regulate the assembly of FliF into the MS-ring structure?

The assembly of FliF into the MS-ring involves a precisely regulated process:

  • Domain interactions: The interplay between RBM domains appears critical, with RBM1 binding to RBM2 to prevent its oligomerization, while RBM3 counteracts this interaction

  • Membrane association: The transmembrane helices likely provide initial anchoring and positioning

  • Sequential assembly: Evidence suggests a coordinated process where specific domains drive initial interactions followed by recruitment of additional subunits

  • Cellular factors: Chaperones and accessory proteins may facilitate proper folding and assembly

Recent findings suggest that the distinct conformations adopted by FliF domains enable the formation of multiple symmetries within a single complex to accommodate both structural stability and interaction with different components of the flagellar system .

How can researchers evaluate the functional impact of FliF mutations in B. subtilis?

To assess the functional consequences of FliF mutations:

  • Motility assays: Measure swimming or swarming ability on semi-solid agar plates to quantify flagellar function

    • Compare colony diameter after 8-24 hours of incubation

    • Analyze swimming tracks using dark-field microscopy

  • Flagellar assembly assessment:

    • Electron microscopy to directly visualize flagellar structures

    • Immunoblotting of cellular fractions to quantify flagellar protein levels

    • Fluorescence microscopy with labeled flagellar components

  • Protein-protein interaction studies:

    • Bacterial two-hybrid analysis to investigate interactions with partner proteins

    • Co-immunoprecipitation to identify changes in complex formation

    • FRET-based approaches for in vivo interaction dynamics

  • Complementation experiments:

    • Express wild-type or mutant constructs in FliF deletion strains

    • Quantify restoration of flagellar function and structure

These approaches should be combined with detailed structural analysis to correlate functional defects with specific structural alterations.

What is the relationship between FliF structure and B. subtilis flagellar rotation?

The MS-ring formed by FliF serves as the foundation for the flagellar motor, directly influencing rotational capabilities:

  • The interaction between FliF and FliG is critical for torque generation, as FliG forms the rotor component that interacts with the stator complexes

  • The distinct symmetries observed in FliF (C11, C23, and C34) likely facilitate the accommodation of different interacting partners within the motor complex

  • Specific regions within FliF may undergo conformational changes during rotation, potentially contributing to the mechanical properties of the motor

  • The structural integrity of the MS-ring affects the stability and efficiency of the entire motor complex

Experimental approaches to study this relationship include high-resolution structural analysis of the FliF-FliG interface, single-molecule techniques to measure torque generation, and real-time imaging of labeled FliF during flagellar rotation.

How conserved is FliF structure and function between B. subtilis and other bacterial species?

FliF shows significant conservation across diverse bacterial species, though with important variations:

  • Domain organization: The three ring-building motifs (RBMs) are highly conserved, with sequence analysis revealing homology to components in various bacterial secretion systems

  • Structural homology: The periplasmic domains of FliF show structural similarity to components found in type III secretion systems and sporulation proteins, including:

    • SctJ/SctD in injectisomes

    • SpoIIIAH and SpoIIIAG in Bacillus sporulation channels

  • Symmetry variations: While the basic MS-ring structure is conserved, the specific symmetry can vary between species:

    • Salmonella SPI-I injectisome forms a 24-fold symmetry

    • Spoulation protein SpoIIIAG forms a 30-fold symmetrical ring

    • B. subtilis FliF displays multiple symmetries within a single complex (C11, C23, C34)

These comparisons highlight the evolutionary relationships between different bacterial secretion and motility systems, suggesting common ancestral origins or convergent solutions to similar biological challenges.

What experimental approaches can assess functional complementation between FliF from different species?

To evaluate cross-species functional complementation:

  • Heterologous expression experiments:

    • Express FliF from different bacterial species in a B. subtilis FliF deletion strain

    • Quantify restoration of motility and flagellar assembly

    • Perform reciprocal experiments in other bacterial systems

  • Domain swapping:

    • Create chimeric FliF proteins with domains from different species

    • Evaluate which regions are interchangeable and which are species-specific

  • Interaction studies:

    • Test whether FliF from one species can interact with flagellar components from another

    • Use bacterial two-hybrid, co-immunoprecipitation, or in vitro binding assays

  • Structural analysis:

    • Compare high-resolution structures from different species

    • Identify conserved interfaces and species-specific features

These approaches can reveal fundamental aspects of flagellar evolution and identify structurally and functionally critical regions of the FliF protein.

What strategies address poor solubility or inclusion body formation during recombinant FliF expression?

Researchers working with recombinant FliF often encounter solubility challenges. Effective strategies include:

  • Optimization of expression conditions:

    • Lower induction temperature (16-20°C)

    • Reduce IPTG concentration (0.1-0.5 mM)

    • Use enriched media (e.g., Terrific Broth)

    • Extend expression time (overnight at lower temperatures)

  • Protein engineering approaches:

    • Express individual domains rather than full-length protein

    • Create fusion constructs with solubility-enhancing partners (MBP, SUMO, TrxA)

    • Remove or modify hydrophobic regions prone to aggregation

  • Refolding protocols for proteins expressed in inclusion bodies:

    • Solubilize in 8M urea or 6M guanidine hydrochloride

    • Perform stepwise dialysis to remove denaturant

    • Add folding enhancers (L-arginine, glycerol, non-detergent sulfobetaines)

  • Co-expression with chaperones:

    • GroEL/GroES system

    • DnaK/DnaJ/GrpE system

    • Trigger factor

These approaches should be systematically tested and optimized for the specific FliF construct being studied.

How can researchers troubleshoot non-native oligomerization of recombinant FliF?

Non-native oligomerization can complicate structural and functional studies. To address this issue:

  • Buffer optimization:

    • Screen different pH conditions (typically 6.5-8.5)

    • Test various salt concentrations (150-500 mM NaCl)

    • Include stabilizing agents (5-10% glycerol, 1-5 mM DTT or TCEP)

  • Detergent screening for constructs with transmembrane domains:

    • Test various detergent types and concentrations

    • Consider lipid supplementation to stabilize native conformation

  • Protein modification:

    • Introduce mutations at non-essential oligomerization interfaces

    • Create truncated constructs eliminating problematic regions

    • Use disulfide engineering to stabilize desired oligomeric states

  • Analytical approaches to characterize oligomeric species:

    • Size exclusion chromatography under various conditions

    • Dynamic light scattering to monitor aggregation

    • Negative-stain EM to directly visualize oligomeric structures

Combining these approaches can help isolate homogeneous, natively folded FliF oligomers for functional and structural studies.

How should researchers approach symmetry analysis in cryoEM studies of FliF?

CryoEM analysis of FliF requires specialized approaches to handle its complex symmetry:

  • Initial processing without symmetry constraints:

    • Perform reference-free 2D classification to identify predominant views

    • Generate initial models without imposing symmetry

    • Use 3D classification to separate particles into homogeneous subsets

  • Symmetry determination:

    • Apply rotational symmetry search algorithms to 3D reconstructions

    • Use Fourier shell correlation between reconstructions with different imposed symmetries

    • Validate through subregion analysis

  • Focused refinement approaches:

    • Apply masks to isolate subregions with different symmetries

    • Perform local refinement with appropriate symmetry parameters

    • Use symmetry expansion for asymmetric features

  • Validation strategies:

    • Cross-validate with independent particle subsets

    • Compare with X-ray crystallography data where available

    • Evaluate biological plausibility of interfaces

These approaches have revealed that B. subtilis FliF adopts two distinct conformations in the M-ring, with 23 chains forming one structure and 11 forming another, while all 34 chains contribute to the S-ring .

What statistical approaches best analyze mutations affecting FliF function?

When analyzing the effects of FliF mutations on flagellar function:

  • Quantitative phenotype measurements:

    • Motility assays (swimming or swarming)

    • Flagellar assembly efficiency

    • Protein-protein interaction strength

    • Motor rotation parameters

  • Appropriate statistical tests:

    • ANOVA with post-hoc tests for comparing multiple mutants

    • Non-parametric tests for data with non-normal distribution

    • Regression analysis for correlating structural parameters with function

  • Effect size calculations:

    • Cohen's d or similar metrics to quantify magnitude of differences

    • Confidence intervals to indicate precision of estimates

  • Structure-function correlation:

    • Multiple regression to identify key structural determinants

    • Principal component analysis to reduce dimensionality of structural data

    • Classification approaches to group mutations by mechanism

  • Data visualization:

    • Heat maps correlating mutation position with functional outcomes

    • Structural mapping of mutation effects

    • Network analysis of interaction perturbations

These approaches enable rigorous interpretation of mutational data and can reveal mechanistic insights into FliF function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.