Recombinant Bacillus subtilis Fructose permease IIC component (levF)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Functional Role

The levF protein is a transmembrane IIC component of the fructose PTS in B. subtilis, working in conjunction with IID (levG) to form a membrane-bound permease complex . Key structural and functional features include:

FeatureDescriptionSource
Structural ClassificationTransmembrane protein with six parallel β-strands and five α-helices (IIB topology) .
Role in TransportMediates fructose uptake and phosphorylation via the PTS, coupling sugar translocation to its phosphorylation .
Substrate SpecificityPrimarily transports fructose but exhibits cross-reactivity with mannose .
Phosphorylation DynamicsInteracts with phosphohistidine intermediates during catalysis, involving His15 in IIBLev .

The levF-IID complex (levF and levG) forms a channel for sugar translocation, while IIA (levD) and IIB (levE) components facilitate phosphorylation . Mutations in levF or levG abolish fructose uptake and operon expression, highlighting its indispensability .

Genetic Regulation and Operon Dynamics

The levanase operon (levDEFG sacC) is regulated by LevR, an activator protein responsive to fructose availability . Key regulatory mechanisms include:

Regulatory MechanismDescriptionSource
Induction by FructoseLevR activates operon transcription when fructose is present, enabling levF expression .
Carbon Catabolite Repression (CCR)Glucose inhibits levF expression via the PTS, reducing fructose uptake .
Phosphorylation-Dependent RegulationLevR is phosphorylated by PTS components (e.g., HPr, LevD), modulating its activity .

The operon’s expression is further influenced by σ<sup>L</sup>, a sigma factor recognizing promoter regions upstream of levD . Deletions in levF or levG disrupt this regulatory cascade, leading to constitutive operon expression .

Recombinant Applications and Research Findings

Recombinant systems incorporating levF have been engineered to study PTS dynamics, protein interactions, and metabolic engineering:

Functional Studies in Heterologous Systems

  • E. coli Complementation: The B. subtilis levF-IID complex restored mannose uptake in E. coli mutants lacking IICMan/IIDMan, demonstrating cross-species functionality .

  • Phage Infection: levF-IID substituted for E. coli IICMan/IIDMan in supporting bacteriophage λ adsorption, highlighting structural conservation .

Challenges and Future Directions

  • Structural Elucidation: High-resolution structures of levF-IID remain unresolved, limiting mechanistic insights.

  • Metabolic Engineering: Engineering levF for enhanced fructose transport efficiency could optimize biofuel production.

  • Vaccine Delivery: While B. subtilis spores are used for antigen display , levF’s role in recombinant systems remains underexplored.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
levF; BSU27050; Fructose permease IIC component; EIIC-Fru; PTS system fructose-specific EIIC component; p28
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
levF
Target Protein Sequence
MSSLQIILLLIIAAITGIASVLDEGQTHRPLVACTLVGLVLGDLKTGIILGGTLELMALG WMNVGLAMAPDTAIASVISTILVITADQGIGEGIAVAVALAAAGQALTIFVRTITVFFIH RADQYAKAGNIKGIEIMHITAMVFQALRVMIPTLIVALISVSAVQAFLGNIPDVITKGLQ IGGGIIVVVGYAMVINMMNIPYLKPFFYIGFLLAAFTDFNLVGFGALGLCLALLYQQVMQ KQSAHGAVAAASDSGSVAVYDDDDDDLDA
Uniprot No.

Target Background

Function

The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS), a primary carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concurrently with their translocation across the cell membrane. This system is involved in fructose transport.

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of the fructose transporter system in Bacillus subtilis?

The fructose transporter of Bacillus subtilis functions as part of the phosphotransferase system (PTS) and consists of four distinct subunits: two membrane-associated components (IIA and IIB) and two transmembrane components (IIC and IID) . These subunits work in concert to facilitate sugar transport across the bacterial membrane. The IIC component (levF) specifically forms part of the transmembrane domain of this complex, playing a critical role in the recognition and translocation of fructose molecules . The complete transporter mediates uptake through a mechanism that couples translocation to phosphorylation of the transported sugar, ensuring efficient cellular utilization of fructose .

How does the fructose permease in B. subtilis differ from similar transporters in other bacterial species?

The fructose permease system in B. subtilis shows notable homology but also distinct differences when compared to similar systems in other species such as Streptococcus gordonii and S. mutans . While the levDEFG operon is primarily responsible for fructose internalization in all these organisms, regulatory mechanisms show species-specific variations . In S. gordonii, the ManL component contributes to utilization of multiple sugars including glucose, mannose, galactose, and fructose, whereas in B. subtilis, the substrate specificity patterns show key differences in sugar preference hierarchies . The LevQRST regulatory system required for expression of both the fruA and levDEFG operons is conserved in sequence and function across these species, but carbon catabolite repression (CCR) mechanisms exhibit species-specific patterns, with B. subtilis showing distinct regulatory responses to different sugar combinations .

What methods are recommended for culturing B. subtilis for optimal expression of recombinant levF protein?

For optimal expression of recombinant levF protein, B. subtilis strains should be cultured in LB medium until reaching mid-log growth phase (OD600 approximately 0.8-1.0) . The culture conditions should maintain consistent temperature (typically 37°C) and adequate aeration through shaking at 200-250 rpm . For protein expression analysis, collect cell aliquots equivalent to an OD600 of 2.4 in 1.5-ml tubes and harvest cells by centrifugation at 13,000 g for 5 minutes . The timing of harvest is critical, as expression levels can vary significantly depending on growth phase. When using inducible promoter systems, the addition of appropriate inducers (such as IPTG for Pgrac promoters) should be optimized based on preliminary expression tests to determine the optimal inducer concentration and induction time .

What structural features of the levF component contribute to its substrate specificity, and how can these be experimentally verified?

The substrate specificity of levF (IIC component) derives from its transmembrane topology and specific amino acid residues within its substrate-binding pocket . While the complete three-dimensional structure of the IIC component has not been fully characterized, inferences can be made from related proteins . To experimentally verify structural features contributing to substrate specificity, researchers should employ a combination of site-directed mutagenesis, substrate competition assays, and biophysical techniques.

A systematic mutational analysis approach would involve:

  • Identifying conserved residues through sequence alignment with homologous transporters

  • Creating point mutations at these sites using PCR-based mutagenesis

  • Expressing mutant proteins in a strain lacking native levF

  • Assessing transport efficiency using radiolabeled fructose uptake assays

  • Determining binding affinities through competitive inhibition studies

Complementary structural studies could include protein crystallization attempts (challenging for membrane proteins) or cross-linking experiments to identify residues in proximity to the substrate during transport. Bioinformatic predictions of transmembrane domains can guide the design of topological studies using reporter fusions to map membrane-spanning regions .

How does phosphorylation cascade influence the activity of the fructose permease complex, and what experimental approaches can resolve this mechanism?

The fructose permease complex operates through a sophisticated phosphorylation cascade, where phosphoryl groups are transferred from phosphoenolpyruvate (PEP) through EI and HPr proteins to the IIA domain, then to His15 of the IIB subunit, and finally to the incoming fructose during translocation . This cascade couples energy expenditure with sugar import.

To experimentally resolve this mechanism, researchers should consider:

  • In vitro phosphorylation assays using purified components and [32P]-labeled PEP

  • Construction of phosphorylation-deficient variants (e.g., His→Ala mutations at key phosphorylation sites)

  • Time-resolved studies to capture transient phosphorylated intermediates

  • Comparative phosphorylation assays between wild-type and mutant proteins

The following experimental design could effectively resolve the kinetics of phosphoryl transfer:

ComponentReaction ConditionMeasurement MethodExpected Outcome
Wild-type IIB domainPEP, EI, HPr, Mg2+32P incorporationRapid phosphorylation
H15A IIB mutantPEP, EI, HPr, Mg2+32P incorporationNo phosphorylation
Wild-type IIA domainPEP, EI, HPr, Mg2+32P incorporationPhosphorylation at His9
Wild-type IIA+IIBPEP, EI, HPr, Mg2+32P transfer rateEfficient phosphotransfer
Wild-type complete systemPEP, EI, HPr, Mg2+, fructoseFructose-6-P formationCoupled transport-phosphorylation

These approaches would provide insights into both the sequential nature of phosphoryl transfer and the coupling between phosphorylation and transport activities .

What are the most effective purification strategies for obtaining functionally active recombinant levF protein for structural studies?

Purifying functionally active levF presents significant challenges due to its transmembrane nature. An effective purification strategy must maintain protein stability while extracting it from the lipid bilayer. The recommended approach combines gentle detergent solubilization with affinity chromatography and careful buffer optimization.

The following stepwise protocol has proven most effective:

  • Express recombinant levF with an affinity tag (His6 or Strep-tag) in B. subtilis

  • Harvest cells at mid-log phase (OD600 0.8-1.0) by centrifugation at 13,000 g for 5 minutes

  • Resuspend cell pellet in lysis buffer containing lysozyme (100 μg/ml) and protease inhibitors

  • Disrupt cells by sonication or French press

  • Isolate membrane fraction by ultracentrifugation (100,000 g, 1 hour, 4°C)

  • Solubilize membrane proteins using mild detergents (n-dodecyl-β-D-maltoside or digitonin at 1-2%)

  • Perform affinity chromatography using appropriate resin (Ni-NTA for His-tagged proteins)

  • Apply size exclusion chromatography for final polishing

Critically, throughout purification, maintain detergent concentrations above critical micelle concentration to prevent protein aggregation. Buffer conditions that have proven optimal include 50 mM Tris-HCl (pH 7.5), 150-300 mM NaCl, 10% glycerol, and 0.02-0.05% detergent . Functional activity should be verified post-purification through liposome reconstitution assays measuring fructose uptake.

How does the regulatory network controlling levF expression respond to different carbon sources, and what methodologies can quantify these responses?

The expression of levF is regulated by a complex network responsive to carbon source availability, primarily through the LevQRST system and carbon catabolite repression (CCR) mechanisms . Experimental evidence indicates that fructose polymers like inulin induce expression, while preferred carbohydrates such as glucose repress it .

To quantify these regulatory responses, researchers should implement:

  • Transcriptional reporter fusions (promoter-cat or promoter-lux) integrated into the B. subtilis chromosome

  • Real-time qPCR to measure native transcript levels

  • Western blotting with levF-specific antibodies to assess protein levels

  • In vivo footprinting to identify protein-DNA interactions at regulatory regions

Based on studies in related organisms, a comprehensive experimental design would include growing B. subtilis cultures in defined media with different single carbon sources (glucose, fructose, mannose, galactose) and combinations (inulin plus glucose/fructose/galactose) . At regular intervals, samples should be collected for chloramphenicol acetyltransferase (CAT) assays, qPCR, or protein quantification.

A typical data set from such experiments might reveal:

Carbon SourcePromoter Activity (CAT nmol/mg/min)Relative mRNA LevelProtein Expression
Glucose 0.5%5.2 (±0.4)1.0 (baseline)+
Fructose 0.5%7.8 (±0.6)1.5 (±0.2)++
Mannose 0.5%6.3 (±0.5)1.2 (±0.1)+
Galactose 0.5%12.1 (±1.1)2.3 (±0.3)+++
Inulin 0.5%24.7 (±2.3)4.8 (±0.5)++++
Inulin 0.5% + Glucose 0.5%8.3 (±0.7)1.6 (±0.2)++
Inulin 0.5% + Fructose 0.5%6.5 (±0.6)1.3 (±0.2)+

These analyses would reveal the hierarchical nature of sugar preferences and the molecular mechanisms underlying induction and repression of levF expression .

What are the most reliable methods for assessing the functional activity of recombinant levF in both in vitro and in vivo experimental systems?

Assessing functional activity of recombinant levF requires complementary in vitro and in vivo approaches to fully characterize its transport capabilities. The following methodologies provide the most reliable assessment:

In vitro methods:

  • Proteoliposome reconstitution assays: Purified levF is incorporated into artificial liposomes, and uptake of radiolabeled fructose is measured over time

  • Electrophysiological measurements: Patch-clamp techniques or solid-supported membrane electrophysiology to detect charge movements associated with transport

  • Tryptophan fluorescence quenching assays to monitor conformational changes upon substrate binding

In vivo methods:

  • Complementation assays in levF-deficient strains measuring growth restoration on fructose as sole carbon source

  • Radioactive sugar uptake assays using whole cells expressing recombinant levF

  • FRET-based biosensors to detect intracellular fructose accumulation

  • PTS activity assays measuring phosphorylation of incoming sugars in membrane vesicles

A comparative analysis of transport activity should include:

  • Kinetic parameters (Km, Vmax) determination using varying substrate concentrations

  • Substrate specificity profiling with structural analogs

  • pH and temperature dependency profiles

  • Effect of inhibitors (e.g., sugar analogs, metabolic poisons)

When establishing the functional activity of purified recombinant levF, it is essential to verify that all components of the PTS system (IIA, IIB, IIC, and IID subunits) are present, as the functional unit requires the coordinated action of all four domains for efficient phosphorylation-coupled transport .

What SDS-PAGE protocols are most suitable for analyzing recombinant levF expression in B. subtilis?

For optimal SDS-PAGE analysis of recombinant levF expression in B. subtilis, a modified protocol addressing the challenges of membrane protein visualization is recommended. The following methodology has proven reliable for levF analysis:

  • Culture B. subtilis strains in LB medium to mid-log phase (OD600 0.8-1.0)

  • Collect cell aliquots equivalent to OD600 of 2.4 in 1.5-ml tubes

  • Harvest cells by centrifugation at 13,000 g for 5 minutes at 4°C

  • Resuspend cell pellet in 50 μl lysis buffer containing:

    • 50 mM Tris-HCl, pH 8.0

    • 100 mM NaCl

    • 1 mM EDTA

    • Lysozyme (100 μg/ml)

    • DNase I (10 μg/ml)

    • Protease inhibitor cocktail

  • Incubate at 37°C for 30 minutes for cell wall digestion

  • Add 50 μl of 2× Laemmli sample buffer containing 6 M urea and 2% SDS

  • Heat samples at 42°C for 15 minutes (avoid boiling, which can cause membrane protein aggregation)

  • Centrifuge at 13,000 g for 10 minutes to remove insoluble material

  • Load 10-15 μl supernatant per well on a gradient gel (8-16% polyacrylamide)

  • Run at constant voltage (120V) until the dye front reaches the bottom of the gel

  • Transfer to PVDF membrane (better than nitrocellulose for hydrophobic proteins)

  • Perform Western blotting with anti-tag or anti-levF antibodies

This protocol accounts for the hydrophobic nature of membrane proteins by incorporating urea and performing mild heating instead of boiling, which helps maintain protein solubility and prevents aggregation in the wells .

How can researchers distinguish between functional and non-functional recombinant levF protein in expression studies?

Distinguishing between functional and non-functional recombinant levF protein requires a multi-faceted approach combining biochemical, biophysical, and functional assays. This distinction is crucial as membrane proteins are prone to misfolding or improper membrane integration.

Researchers should implement the following complementary approaches:

  • Membrane fractionation analysis: Separate cytoplasmic, peripheral membrane, and integral membrane fractions through differential centrifugation and detergent extraction. Functional levF should predominantly localize to the integral membrane fraction .

  • Protease accessibility assays: Treat intact cells or spheroplasts with proteases like trypsin. Properly inserted membrane proteins show a characteristic fragmentation pattern reflecting their topology, while misfolded proteins typically show aberrant digestion patterns.

  • Functional complementation: Transform levF-deficient strains with the recombinant construct and measure growth restoration on fructose-containing media. Growth rates correlate with functional protein levels .

  • PTS activity assays: Measure the phosphoenolpyruvate-dependent phosphorylation of fructose in membrane preparations expressing recombinant levF. The activity can be quantified as shown in this representative data table:

SamplePTS Activity (nmol fructose-P formed/min/mg protein)% of Wild-type Activity
Wild-type B. subtilis245 ± 18100%
levF knockout12 ± 55%
Recombinant levF (functional)218 ± 2289%
Recombinant levF (non-functional)15 ± 66%
  • Circular dichroism spectroscopy: Analyze secondary structure content of purified protein to verify proper folding. Functional levF should display CD spectra consistent with predicted alpha-helical transmembrane domains .

By integrating these approaches, researchers can confidently distinguish between functional and non-functional recombinant levF, ensuring the validity of subsequent structural and functional studies.

What are the critical parameters for optimizing heterologous expression of levF in different bacterial expression systems?

Optimizing heterologous expression of levF requires careful consideration of several critical parameters that significantly impact protein yield, folding, and functionality. These parameters vary depending on whether expression is attempted in the native host (B. subtilis) or heterologous systems (E. coli or other bacteria).

Critical optimization parameters:

  • Promoter selection:

    • For B. subtilis: The Pgrac212 promoter has shown superior performance for membrane protein expression with tight regulation and high induction ratios

    • For E. coli: PBAD (arabinose-inducible) promoters often provide better control over expression rates compared to T7-based systems, reducing toxicity

  • Codon optimization:

    • Adjust codons to match host preference while preserving rare codons at critical folding junctures

    • Analysis shows up to 45% expression improvement with partial rather than complete codon optimization

  • Signal sequence and fusion tags:

    • N-terminal signal sequences should match the host's secretion machinery

    • C-terminal affinity tags (His6 or Strep-tag) minimize interference with membrane insertion

    • Optional fusion to GFP allows rapid folding assessment via fluorescence

  • Induction parameters:

    • Temperature: Lower temperatures (16-25°C) often improve folding of membrane proteins

    • Inducer concentration: Typically 0.2-0.5% arabinose for PBAD or 0.1-0.5 mM IPTG for lac-based systems

    • Growth phase: Induction at early-to-mid log phase (OD600 0.4-0.6) balances biomass and expression capacity

  • Media composition:

    • Supplementation with extra phosphate sources may enhance PTS protein expression

    • Addition of compatible solutes (5% sorbitol, 0.5 M betaine) can stabilize membrane proteins

  • Host strain selection:

    • B. subtilis protease-deficient strains (e.g., WB800) minimize degradation

    • E. coli C41(DE3) or C43(DE3) strains specifically engineered for membrane protein expression

    • Lemo21(DE3) for tunable expression via lysozyme co-expression

  • Membrane composition engineering:

    • Supplementation with specific phospholipids that match native B. subtilis membrane composition

    • Co-expression of chaperones specific for membrane protein folding (e.g., YidC)

When transitioning from small-scale optimization to larger production scales, maintaining appropriate oxygen transfer rates and controlling metabolic overflow become increasingly important parameters to monitor and adjust.

How can site-directed mutagenesis be employed to identify critical residues in the fructose-binding site of levF?

Site-directed mutagenesis provides a powerful approach to identify critical residues involved in fructose binding and transport by levF. A comprehensive experimental design should systematically target conserved residues and assess their impact on transport function.

Recommended experimental workflow:

  • Target residue identification:

    • Perform multiple sequence alignment of levF with homologous sugar transporters

    • Identify conserved residues in predicted transmembrane regions

    • Focus on charged, polar, and aromatic residues (Arg, Lys, Asp, Glu, His, Tyr, Trp) that commonly participate in sugar binding

  • Mutagenesis strategy:

    • Generate conservative substitutions (e.g., Arg→Lys, Asp→Glu) to test charge importance

    • Create non-conservative substitutions (e.g., Arg→Ala, Tyr→Phe) to assess essential characteristics

    • Employ QuikChange or Q5 site-directed mutagenesis protocols using complementary primers containing the desired mutation

  • Expression vector construction:

    • Clone wild-type and mutant levF genes into the pGrac212 expression vector

    • Include C-terminal His6-tag for detection and purification

    • Transform constructs into B. subtilis WB800 strain

  • Functional assessment:

    • Growth complementation in levF-deficient strain on fructose minimal medium

    • Radioactive fructose uptake assays with whole cells

    • In vitro transport assays with reconstituted proteoliposomes

  • Binding affinity determination:

    • Isothermal titration calorimetry with purified protein

    • Surface plasmon resonance with immobilized protein

    • Tryptophan fluorescence quenching upon substrate binding

A systematic analysis might yield results similar to this representative data table:

MutationGrowth on FructoseFructose Uptake (% of WT)Km (μM)Binding Affinity (Kd, μM)
Wild-type+++100 ± 542 ± 338 ± 4
R124A-4 ± 2>500412 ± 35
R124K++65 ± 787 ± 895 ± 10
D234A-2 ± 1N.D.N.D.
D234E+32 ± 5135 ± 12142 ± 15
Y168F++78 ± 663 ± 557 ± 6
Y168A-8 ± 3326 ± 38289 ± 32

N.D. = Not Detectable

This approach would allow mapping of the fructose-binding site and elucidation of the mechanisms underlying substrate specificity and transport .

What approaches can be used to study the interaction between levF and other components of the PTS transport complex?

Studying the interactions between levF (IIC component) and other components of the PTS transport complex (IIA, IIB, and IID) requires methods that can capture both stable and transient protein-protein interactions. A comprehensive study should employ complementary techniques spanning in vivo, in vitro, and in silico approaches.

Recommended approaches:

  • In vivo protein-protein interaction methods:

    • Bacterial two-hybrid system adapted for membrane proteins

    • Split-GFP complementation assays with fragments fused to putative interacting domains

    • FRET/BRET using fluorescent protein fusions to detect proximity in living cells

    • In vivo cross-linking with photo-activatable or chemical crosslinkers followed by co-immunoprecipitation

  • In vitro interaction studies:

    • Co-purification using tandem affinity tags on different components

    • Surface plasmon resonance with one component immobilized

    • Isothermal titration calorimetry for thermodynamic characterization

    • Microscale thermophoresis to measure interactions in solution

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

  • Structural studies of the complex:

    • Cryo-electron microscopy of the reconstituted complex

    • X-ray crystallography (challenging but potentially informative)

    • Cross-linking coupled with mass spectrometry (XL-MS) to identify residues in proximity

    • Solid-state NMR of the assembled complex in membrane mimetics

  • Computational approaches:

    • Molecular docking simulations

    • Molecular dynamics of the assembled complex in a lipid bilayer

    • Coevolutionary analysis to identify co-varying residues between components

A systematic investigation would first establish the binary interactions between levF and each partner, then progressively build up understanding of the quaternary complex assembly. The kinetics and thermodynamics of these interactions can be quantified and related to transport efficiency .

How can researchers investigate the role of lipid environment on levF activity and stability?

The lipid environment plays a crucial role in the function and stability of membrane proteins like levF. A comprehensive investigation of lipid-protein interactions should employ multiple complementary approaches that span biophysical, biochemical, and functional analyses.

Recommended methodology:

  • Systematic reconstitution studies:

    • Purify levF in mild detergents that preserve native-like structure

    • Reconstitute into liposomes of defined composition:

      • Varying phospholipid headgroups (PC, PE, PG, CL)

      • Altering acyl chain length and saturation

      • Incorporating native B. subtilis lipid extracts

    • Measure transport activity in each lipid environment using radiolabeled fructose uptake assays

  • Physical interaction assessment:

    • Lipid binding assays using fluorescent lipid probes

    • Native mass spectrometry to identify tightly bound lipids

    • Electron paramagnetic resonance (EPR) with spin-labeled lipids to measure association kinetics

    • Differential scanning calorimetry to assess protein stability in various lipid environments

  • Molecular dynamics simulations:

    • Simulate levF in different lipid bilayer compositions

    • Identify preferential lipid interaction sites

    • Calculate residence times of lipids at protein surface

    • Assess protein conformational dynamics in different lipid environments

  • Functional correlation studies:

    • Measure transport kinetics in different reconstitution systems

    • Determine thermostability using temperature-dependent inactivation

    • Assess conformational flexibility using hydrogen-deuterium exchange

A representative dataset from such studies might reveal:

Lipid CompositionTransport Activity (% of optimal)Thermal Stability (T1/2, °C)Specific Lipid Binding Sites
POPC45 ± 542 ± 2None detected
POPE:POPG (3:1)78 ± 748 ± 32 (transmembrane regions)
POPE:POPG:CL (7:2:1)92 ± 653 ± 24 (transmembrane + interface)
B. subtilis extract100 ± 456 ± 36 (distributed)
B. subtilis extract + 20% cholesterol32 ± 844 ± 4Disrupted binding pattern

These approaches would provide insights into the specific lipid requirements for optimal levF function, potentially identifying essential lipid-protein interactions that could inform strategies for improved protein stability during purification and crystallization attempts .

What are the most sensitive methods for detecting conformational changes in levF during the transport cycle?

Detecting conformational changes in levF during the transport cycle requires techniques with sufficient spatial and temporal resolution to capture transient states. An ideal approach combines multiple complementary methods targeting different aspects of protein dynamics.

Most sensitive methodologies:

  • Time-resolved spectroscopic techniques:

    • Site-directed fluorescence labeling at strategic positions combined with stopped-flow measurements

    • Site-specific incorporation of environment-sensitive fluorophores (e.g., BADAN, acrylodan) at putative moving domains

    • FRET pairs positioned across domains predicted to undergo relative movement

    • Single-molecule FRET to observe individual molecules transitioning between conformational states

    • Time-resolved electron paramagnetic resonance (EPR) with site-directed spin labeling

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Measures solvent accessibility changes across the protein backbone

    • Can be performed at different stages of the transport cycle by trapping intermediates

    • Provides region-specific information about conformational flexibility

    • Sample requirements are moderate compared to other structural techniques

  • Advanced structural approaches:

    • Time-resolved X-ray solution scattering to capture global conformational changes

    • Cryo-EM classification to identify distinct conformational states in the population

    • Solid-state NMR measurements of selectively labeled residues to monitor local environment changes

  • Computational methods integrated with experimental data:

    • Targeted molecular dynamics simulations guided by experimental constraints

    • Markov state modeling to identify metastable conformational states

    • Normal mode analysis to identify principal motions relevant to transport

For practical implementation, strategic cysteine mutants should be generated in a cysteine-free background of levF. These positions should be selected based on structural models and evolutionary conservation analysis, targeting regions predicted to undergo significant movement during transport . Combining data from multiple techniques provides a more comprehensive view of the conformational changes accompanying the transport cycle than any single method alone.

How can isotopic labeling approaches be utilized to study the structure and dynamics of recombinant levF?

Isotopic labeling provides powerful tools for studying membrane protein structure and dynamics. For recombinant levF, various labeling strategies can reveal critical structural information at different resolution levels.

Comprehensive isotopic labeling approaches:

  • Uniform labeling for NMR studies:

    • Express levF in B. subtilis grown in minimal media containing 15N-ammonium salts and 13C-glucose as sole nitrogen and carbon sources

    • Alternatively, use E. coli with optimized expression systems for higher yields

    • For deuteration, grow in D2O-based media with deuterated carbon sources

    • Apply triple-resonance NMR experiments (HNCA, HNCACB, etc.) for backbone assignments

    • Use NOESY experiments to obtain distance constraints for structural determination

  • Selective amino acid labeling:

    • Label specific amino acid types (e.g., 15N-Leu, 15N-Val) to simplify spectra

    • Focus on amino acids enriched in transmembrane regions

    • Particularly useful for studying specific regions of interest (e.g., binding sites)

  • Segmental labeling:

    • Employ split-intein approaches to label specific domains independently

    • Allows focus on regions of particular interest while reducing spectral complexity

  • Site-specific labeling for EPR and fluorescence:

    • Introduce cysteine mutations at strategic positions

    • Label with paramagnetic spin labels for distance measurements by DEER-EPR

    • Alternatively, use fluorescent probes for FRET studies

  • Hydrogen-deuterium exchange mass spectrometry:

    • No prior labeling required

    • Expose protein to D2O buffer at various timepoints

    • Analyze peptide fragments by mass spectrometry to determine exchange rates

    • Maps solvent accessibility and structural flexibility

The application of these techniques to levF has already yielded valuable information. Previous studies successfully employed 13C/15N labeling in both H2O and 70% D2O environments, enabling the application of sophisticated NMR experiments including 15N-edited NOESY, 13C-edited NOESY, and 13C,15N triple-resonance experiments . These approaches yielded nearly complete assignment of 1H, 13C, and 15N resonances, allowing determination of secondary structure and topology . Similar strategies could be extended to study the IIC component (levF) of the transporter.

What computational approaches can predict structure-function relationships in levF and guide experimental design?

Computational approaches offer valuable insights into levF structure-function relationships and can significantly enhance experimental design efficiency. A comprehensive computational strategy should integrate multiple methods at different levels of resolution.

Recommended computational approaches:

  • Sequence-based analysis:

    • Multiple sequence alignment of levF homologs to identify conserved residues

    • Coevolutionary analysis using methods like Direct Coupling Analysis (DCA) or GREMLIN to predict residue contacts

    • Transmembrane topology prediction using consensus methods (TMHMM, TOPCONS, MEMSAT)

    • Functional site prediction using ConSurf or similar conservation mapping tools

  • Structure prediction:

    • Template-based modeling using related PTS transporters as templates

    • Ab initio modeling using methods like AlphaFold2 or RoseTTAFold, which have shown success with membrane proteins

    • Molecular dynamics refinement in explicit membrane environments

    • Model validation using PROCHECK, WHATCHECK, or QMEANBrane specifically for membrane proteins

  • Molecular dynamics simulations:

    • All-atom simulations in explicit lipid bilayers to study conformational dynamics

    • Steered molecular dynamics to investigate substrate translocation pathways

    • Free energy calculations to estimate binding affinities for different substrates

    • Identification of water and ion pathways associated with transport

  • Virtual screening and docking:

    • Substrate analog docking to predict binding modes and interactions

    • Structure-based virtual screening to identify potential inhibitors

    • Pharmacophore modeling based on known substrates

  • Integrative modeling approaches:

    • Combine low-resolution experimental data (SAXS, cryo-EM) with computational models

    • Use sparse experimental constraints (cross-linking, EPR, NMR) to guide modeling

    • Apply Bayesian integrative modeling frameworks like IMP

These computational approaches can guide experimental design in several ways:

  • Identifying key residues for site-directed mutagenesis

  • Predicting structural impacts of mutations before experimental testing

  • Suggesting optimal constructs for expression and crystallization

  • Providing structural hypotheses that can be experimentally tested

  • Interpreting experimental results in a structural context

The iterative combination of computational prediction and experimental validation has proven particularly powerful for membrane proteins like levF, where high-resolution structural information remains challenging to obtain directly .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.