Recombinant Bacillus subtilis Glycerol uptake facilitator protein (glpF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant B. subtilis GlpF

Recombinant B. subtilis GlpF is a membrane channel protein belonging to the major intrinsic protein (MIP) family, specifically categorized as an aquaglyceroporin that facilitates the selective transport of small molecules such as glycerol and water across the cell membrane through concentration gradient-driven diffusion . Unlike some bacteria that possess both aquaporin-Z (AqpZ) and GlpF, B. subtilis has only GlpF as its water channel protein, making it particularly significant for cellular functions involving water and glycerol transport . The recombinant production of this protein has enabled detailed structural and functional studies, advancing our understanding of membrane transport processes and opening avenues for biotechnological applications.

The significance of GlpF in B. subtilis extends beyond simple transport functions, as it plays crucial roles in glycerol metabolism, osmoregulation, and notably in spore germination processes. Recent research has highlighted its importance in controlling water influx during spore germination, a finding with significant implications for food safety applications . The ability to produce and manipulate recombinant GlpF has transformed our capacity to study and exploit this protein's unique properties.

Gene Structure and Organization of glpF in B. subtilis

The glpF gene in B. subtilis is located within the glpPFKD region at approximately 75° on the chromosomal map, forming part of the glycerol regulon essential for growth on glycerol or glycerol 3-phosphate (G3P) . This region contains three operons: glpP (encoding a regulatory protein), glpFK (encoding glycerol uptake facilitator and glycerol kinase), and glpD (encoding G3P dehydrogenase) . Within this organization, glpF is positioned immediately upstream of glpK, and these two genes constitute a single operon that is transcribed separately from glpP .

Molecular characterization has identified a sigma A-type promoter and the transcriptional start point for the glpFK operon . In the 5' untranslated leader sequence of glpFK mRNA, researchers discovered a conserved inverted repeat believed to be involved in controlling gene expression through termination/antitermination of transcription . This regulatory mechanism ensures that genes for glycerol utilization are expressed only when needed.

The expression of glpFK and glpD requires both the inducer G3P and the glpP gene product . The GlpP protein functions as an antiterminator, allowing transcription to proceed past terminator structures when G3P is present, thus linking gene expression to substrate availability . This sophisticated regulatory mechanism exemplifies how bacteria optimize their metabolic resources according to environmental conditions.

Expression and Purification of Recombinant GlpF

B. subtilis serves as an excellent host for recombinant protein expression due to its GRAS (Generally Recognized As Safe) status, natural competence for DNA uptake, endotoxin-free nature, efficient secretion systems, and ability to grow on inexpensive carbon sources. For recombinant GlpF expression, several systems have been developed using both constitutive and inducible promoters.

A typical protocol for recombinant GlpF expression and purification involves:

  1. Cloning the glpF gene into an expression vector

  2. Transformation into an appropriate host strain

  3. Culture growth under optimal conditions

  4. Induction of protein expression (often with IPTG)

  5. Cell harvesting and lysis via French press

  6. Membrane fraction isolation

  7. Solubilization of membrane proteins with detergents

  8. Affinity purification using Ni-NTA-agarose for His-tagged proteins

Researchers have successfully used plasmid pLUM7 containing a 2.9 kb B. subtilis chromosomal DNA fragment with the glpP open reading frame, demonstrating functionality through complementation of various glpP mutants . This approach has enabled detailed studies of GlpF's structure and function, contributing significantly to our understanding of this important membrane protein.

Functional Properties and Kinetics of Recombinant GlpF

Functional studies on recombinant B. subtilis GlpF have revealed its transport characteristics and kinetic parameters. GlpF primarily facilitates glycerol transport across the cell membrane through a pore-type mechanism rather than a carrier-mediated process. Kinetic analyses have demonstrated that glycerol transport via GlpF is non-saturable up to concentrations of 200 mM, characteristic of channel-facilitated diffusion .

The transport exhibits a low activation energy (Ea = 4.5 kcal/mol), consistent with passive diffusion through a pore rather than an energy-requiring process . This property distinguishes GlpF from active transporters and confirms its classification as a facilitator protein that accelerates the equilibration of glycerol across the membrane according to its concentration gradient.

While B. subtilis GlpF shows preference for glycerol, it may also facilitate the transport of water, though at lower rates compared to dedicated water channels like AqpZ . The selectivity of GlpF for different substrates is determined by the structural features of its conduction pathway, particularly the aromatic/arginine (ar/R) selectivity filter that influences which molecules can traverse the channel.

Functional complementation studies have demonstrated that recombinant GlpF can restore glycerol uptake in GlpF-deficient strains, confirming its role as a glycerol facilitator . These studies typically measure growth rates on glycerol as the sole carbon source or use radiolabeled glycerol to directly quantify transport rates, providing valuable insights into the protein's function in vivo.

Role of GlpF in B. subtilis Spore Germination

Recent research has uncovered a significant role for GlpF in B. subtilis spore germination, a process where dormant spores return to vegetative growth. This process involves the hydration of the spore core region accompanied by the loss of spore resistance properties . The precise mechanism of water transport during this critical transition has been poorly understood until recent investigations focusing on GlpF.

Studies with glpF mutants and overexpression strains have revealed remarkable effects on spore germination patterns. Researchers constructed glpF mutants and overexpression strains and discovered that while deletion of glpF did not affect the growth of bacterial vegetative cells and spores, it significantly impacted germination dynamics . Specifically, germination experiments on spores of glpF-deficient strains showed an increased germination rate, as measured by calcium dipicolinate (DPA) release and changes in spore absorbance .

Interestingly, increasing water activity did not affect the results caused by glpF deletion, suggesting a complex regulatory role rather than simple water transport . Meanwhile, overexpressed glpF affected the permeability of the spore coat, indicating that the protein influences barrier properties of spore structures . Perhaps most significantly for applications, spores lacking glpF were more susceptible to inactivation by ultra-high pressure treatment, a finding with potential implications for food safety technology .

These results collectively suggest that GlpF plays an important regulatory role in controlling water transport during spore germination, possibly by regulating the rate of water entry into the spore core. This function appears distinct from its role in glycerol uptake in vegetative cells, highlighting the multifunctional nature of this membrane channel protein.

Biotechnological Applications of Recombinant B. subtilis GlpF

Recombinant B. subtilis GlpF has found several biotechnological applications, leveraging its ability to facilitate glycerol transport and its involvement in cellular processes:

  1. Enhanced glycerol utilization: Overexpression of recombinant GlpF improves glycerol uptake in various bacterial strains, enabling more efficient conversion of this abundant byproduct of biodiesel production into valuable compounds.

  2. Production of 3-hydroxypropanoic acid (3-HP): In B. subtilis, recombinant GlpF functions as an efficient glycerol facilitator for converting glycerol to 3-HP, achieving production titers of 10 g/L in shake flasks. Upregulation of glpF expression has been suggested as a strategy to further enhance glycerol uptake and improve 3-HP production.

  3. Glycerol-inducible expression systems: The natural regulation of the glpF gene has been exploited to develop expression systems that use glycerol as an inducer for high-level protein production, including enzymes like nattokinase and aspartase.

  4. Cross-species applications: Heterologous expression of B. subtilis glpF (along with glpK and glpD) has enabled other bacteria like Corynebacterium glutamicum to utilize glycerol for amino acid production, expanding the substrate range of these industrial strains.

  5. Spore technology: The role of GlpF in spore germination has potential applications in controlling spore inactivation in the food industry, where killing bacterial spores is an important challenge . The finding that spores lacking glpF are more susceptible to high-pressure inactivation provides a potential strategy for food preservation technologies.

These applications demonstrate how recombinant GlpF can be used to create effective expression systems, enable alternative carbon source utilization, and facilitate the production of valuable compounds from renewable resources.

Comparative Analysis with Other Aquaporins

Comparative analyses between B. subtilis GlpF and similar proteins have provided insights into the functional and structural diversity of aquaporins. E. coli GlpF selectively transports glycerol but has limited water permeability, in contrast to dedicated water channels like AqpZ . This functional specialization reflects the distinct physiological roles of these channel proteins.

Phylogenetic analysis comparing GlpF from spore-producing bacteria shows moderate sequence consistency (approximately 30%) between B. subtilis GlpF and AqpZ proteins . This evolutionary relationship places B. subtilis GlpF within the broader context of the MIP family, with implications for understanding the functional divergence of these proteins across different species.

Human AQP7 exhibits significantly greater water and glycerol permeability than bacterial GlpF, with structural differences explaining these functional variations. The enhanced permeability of mammalian aquaglyceroporins may be attributed to differences in the pore-lining residues and the structure of the selectivity filter, highlighting how evolutionary pressures have shaped these proteins for specific physiological requirements.

Structural comparisons between GlpF and other aquaporins reveal similarities in their central regions but distinct differences at cytoplasmic and extracellular surfaces. These differences contribute to the distinct functional properties of these channel proteins, particularly regarding their substrate selectivity and transport rates. The comparative analysis provides valuable insights into structure-function relationships and helps explain the diverse roles of these proteins across different organisms.

Future Research Directions and Challenges

Research on recombinant B. subtilis GlpF continues to evolve, with several promising directions for future investigation:

  1. Detailed structural studies specifically of B. subtilis GlpF using techniques like cryo-EM or X-ray crystallography would provide more accurate insights into its specific features, as most current structural knowledge comes from E. coli GlpF.

  2. Further investigation into how GlpF activity is regulated at the protein level could reveal mechanisms for controlling membrane permeability to glycerol and water, with potential applications in synthetic biology and metabolic engineering.

  3. Protein engineering approaches could modify GlpF for improved glycerol transport, altered substrate specificity, or enhanced stability, with applications in biotechnology and industrial processes.

  4. Expanding research on GlpF's role in spore germination could lead to novel food preservation strategies and antimicrobial approaches targeting bacterial spores, which remain challenging contaminants in many industries.

  5. Understanding the interaction between GlpF and other components of the glycerol utilization pathway could inform the development of more efficient systems for glycerol bioconversion into high-value products.

These research directions promise to expand our understanding of this important membrane channel protein and develop new applications in biotechnology, food safety, and sustainable bioprocessing.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
glpF; BSU09280; Glycerol uptake facilitator protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-274
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
glpF
Target Protein Sequence
MTAFWGEVIGTMLLIIFGAGVCAGVNLKKSLSFQSGWIVVVFGWGLGVAMAAYAVGGISGAHLNPALTIALAFVGDFPWKEVPVYIAAQMIGAIIGAVIIYLHYLPHWKSTDDPAAKLGVFSTGPSIPHTFANVLSEVIGTFVLVLGILAIGANQFTEGLNPLIVGFLIVAIGISLGGTTGYAINPARDLGPRIAHAFLPIPGKGSSNWKYAWVPVVGPILGGSFGGVFYNAAFKGHITSSFWIVSVILVVVLLGLYVYTKSHSAKTLSNSKYI
Uniprot No.

Target Background

Function
The glycerol uptake facilitator protein (GlpF) is a membrane protein that facilitates glycerol transport across the cytoplasmic membrane via facilitated diffusion.
Database Links
Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the GlpF protein in Bacillus subtilis?

GlpF in Bacillus subtilis is a membrane protein that functions as a glycerol uptake facilitator. It belongs to the aquaglyceroporin family of channel proteins that facilitate the diffusion of glycerol across the cell membrane. The gene encoding GlpF is part of the glpPFKD region, which contains genes essential for growth on glycerol or glycerol 3-phosphate (G3P) . Unlike some other bacteria that have multiple water channel proteins, B. subtilis has only one water channel protein, GlpF, which is located on the inner membrane of both vegetative cells and spores .

How is the glpF gene organized in the B. subtilis genome?

The glpF gene in B. subtilis is located immediately upstream of glpK, and these two genes constitute a single operon, transcribed separately from glpP. The glpP gene encodes a regulatory protein essential for glpF expression. The organization follows this pattern:

  • glpP - encodes a regulatory protein

  • glpF - encodes the glycerol uptake facilitator

  • glpK - likely encodes glycerol kinase

  • glpD - encodes G3P dehydrogenase

A sigma A-type promoter and the transcriptional start point for glpFK have been identified in the genome. In the 5' untranslated leader sequence (UTL) of glpFK mRNA, a conserved inverted repeat is found, which is believed to be involved in the control of expression through termination/antitermination of transcription .

What regulates glpF expression in B. subtilis?

Expression of the glpFK operon in B. subtilis requires two key components:

  • The inducer glycerol 3-phosphate (G3P)

  • The glpP gene product

The regulation mechanism involves a conserved inverted repeat found in the 5' untranslated leader sequence of glpFK mRNA. This repeat is believed to participate in the control of expression through termination/antitermination of transcription, similar to the control mechanism previously suggested for the regulation of glpD encoding G3P dehydrogenase . The regulatory system ensures that glycerol transport machinery is only expressed when glycerol or G3P is available as a carbon and energy source.

What functional roles does GlpF play in bacterial physiology?

GlpF in B. subtilis serves multiple physiological functions:

  • Glycerol Transport: Primarily, GlpF functions as a facilitator for glycerol uptake in vegetative cells, essential for utilizing glycerol as a carbon and energy source .

  • Water Transport: Unlike some specialized aquaporins, GlpF can transport both glycerol and water molecules across the membrane, though its water permeability has been debated in comparison to specialized water channels like AqpZ in E. coli .

  • Spore Germination Regulation: Recent studies have shown that GlpF plays an important role in spore germination. Interestingly, deletion of glpF accelerates germination, while overexpression slows it down, suggesting a regulatory role in controlling water influx during the germination process .

  • Spore Resistance: GlpF contributes to spore resistance, as spores lacking glpF were found to be more susceptible to inactivation by ultra-high pressure treatment .

How does GlpF affect spore germination in B. subtilis?

Recent research using B. subtilis PY79 as a model strain has revealed intriguing effects of GlpF on spore germination. Contrary to initial expectations, deletion of the glpF gene accelerated the germination process rather than inhibiting it. When germinants such as AGFK (a mixture of asparagine, glucose, fructose, and potassium) were added to spore suspensions, glpF-deficient spores (strain BS01) began germinating earlier than wild-type spores, with notable differences observed approximately 10 minutes after germinant addition .

The release of dipicolinic acid (DPA), a key event during early germination stages, also occurred faster in glpF-deficient spores. This effect was most pronounced with AGFK as a germinant, while a smaller acceleration was observed with L-alanine and L-valine .

Conversely, a GlpF overexpression strain (BS02) exhibited slower germination in the presence of various germinants. This suggests that rather than simply facilitating water entry during germination, GlpF might actually regulate or control the rate of water influx, potentially serving as a gatekeeper that moderates the germination process .

What molecular mechanisms underlie glycerol permeation through GlpF?

The permeation of glycerol through GlpF involves sophisticated molecular interactions and energy dynamics:

  • Selectivity Filter: The ar/R (aromatic/arginine) selectivity filter plays a crucial role in determining which molecules can pass through GlpF. Transport through GlpF is mainly influenced by this selectivity filter, which creates a size restriction and specific chemical environment .

  • Competition for Hydrogen Bonds: Glycerol conduction through GlpF involves an inherent competition between water and glycerol molecules for hydrogen bonds with channel-lining residues. Interestingly, water is indispensable for glycerol conduction, suggesting a cooperative transport mechanism .

  • Free-Energy Landscape: The free-energy landscape of glycerol permeation has been studied using various computational methods, including steered molecular dynamics (SMD) simulations and adaptive biasing force (ABF) simulations. Recent research using the fluctuation-dissipation theorem (FDT) of Brownian dynamics has produced results that align with experimental data, providing a more accurate understanding of the energy barriers in glycerol transport .

  • Pore-Lining Residues: Multiple pore-lining residues, not just the conserved arginine in the selectivity filter, modulate the passage of water and glycerol through GlpF. Long-term molecular dynamics simulations have revealed that the positions and dynamics of these residues significantly impact permeability .

How can GlpF be engineered to modulate water permeability?

Recent research has demonstrated that GlpF water permeability can be engineered through strategic mutations, particularly those affecting the conserved arginine in the selectivity filter. Studies with Escherichia coli GlpF have shown that modulating the position of this highly conserved arginine enhances or reduces the unitary water permeability .

Specific mutations and their effects include:

MutationEffect on Water PermeabilityChange Relative to Wild Type
V29EIncreased+60%
V29KDecreased-29%

These findings provide strong experimental evidence that aquaporin water permeability can be regulated by modifications to the ar/R selectivity filter. Additionally, the research suggests that water permeability can be naturally regulated by lipid bilayer asymmetry and transmembrane potential .

For researchers interested in biotechnological applications, these insights open possibilities for engineering GlpF variants with customized permeability properties for specific applications.

What methodological approaches provide accurate measurements of GlpF permeability?

Several methodological approaches have been employed to study GlpF permeability, each with distinct advantages:

  • Computational Methods:

    • Steered Molecular Dynamics (SMD): Uses external forces to guide molecules through the channel, but results may vary based on implementation details.

    • Adaptive Biasing Force (ABF) Simulations: An equilibrium method that has shown qualitative disagreement with some SMD results.

    • SMD with Fluctuation-Dissipation Theorem (FDT): A newer approach that uses mechanical work for extracting free-energy differences, showing better agreement with experimental data .

    • Long-term MD Simulations: Extended simulations (>1 μs) provide more accurate permeability data than shorter simulations, as evidenced by the observation that water permeation events per 100 ns decreased significantly after the 500 ns mark .

  • Experimental Methods:

    • Spectrophotometric Measurements: Monitoring decreases in absorbance to characterize spore germination.

    • Real-time DPA Release Detection: Measuring the release of dipicolinic acid as a marker of germination progress.

    • Phase-contrast Microscopy: Observing and quantifying brightness changes during phase transitions of spores .

    • Fluorescence Correlation Spectroscopy: Estimating protein reconstitution efficiency in vesicles .

For accurate permeability measurements, researchers should consider combining computational predictions with experimental validation, recognizing that longer simulation times may be necessary to capture the true permeability characteristics of GlpF.

How do phylogenetic variations in GlpF affect its function across bacterial species?

Phylogenetic analysis of aquaporins in spore-forming bacteria has revealed interesting evolutionary relationships between GlpF and other water channel proteins. Analysis including 7 AqpZ and 203 GlpF proteins from representative species showed that the sequence consistency between B. subtilis GlpF (strain 168) and AqpZ is relatively moderate, reaching approximately 30% .

Unlike some bacteria that possess multiple water channel proteins, B. subtilis has only one (GlpF), which is localized on the inner membrane of both vegetative cells and spores. This singular presence suggests that GlpF in B. subtilis may have evolved to perform multiple functions related to both glycerol and water transport .

The conservation of specific residues across different bacterial species, particularly those in the selectivity filter, correlates with functional differences in permeability and substrate specificity. These phylogenetic variations provide valuable insights for researchers interested in understanding the evolution of transport mechanisms and for engineering GlpF variants with desired properties.

How can one construct and validate glpF mutants in B. subtilis?

Construction and validation of glpF mutants in B. subtilis typically follows these methodological steps:

  • Gene Deletion:

    • Target the glpF gene for deletion using homologous recombination techniques.

    • Create a deletion construct containing antibiotic resistance markers flanked by sequences homologous to regions upstream and downstream of glpF.

    • Transform the construct into B. subtilis and select for transformants on appropriate antibiotic-containing media.

  • Overexpression System:

    • Clone the glpF gene into an expression vector with an inducible promoter (e.g., IPTG-inducible).

    • Integrate the construct into the B. subtilis chromosome at a neutral locus.

    • Induce expression during specific growth phases (e.g., during sporulation) by adding IPTG .

  • Validation Approaches:

    • Growth Phenotype Analysis: Confirm that deletion of glpF does not affect vegetative cell growth on standard media but may impact growth on glycerol as the sole carbon source .

    • Complementation Assay: Verify the functionality of cloned glpF by its ability to complement glpF mutants, as demonstrated with plasmid pLUM7 which contains a functional glpP gene that complements various glpP mutants .

    • Spore Germination Assay: Monitor changes in absorbance using spectrophotometry to characterize spore germination rates in response to germinants like AGFK or L-alanine .

    • DPA Release Measurement: Quantify dipicolinic acid release as a marker of germination progress .

  • Localization Studies:

    • Use fluorescent protein fusions or immunofluorescence microscopy to confirm the localization of GlpF in the inner membrane of vegetative cells and spores.

These methodological approaches provide a comprehensive framework for constructing and validating glpF mutants to investigate the protein's function in different physiological contexts.

What are the critical parameters for studying GlpF-mediated transport in vitro?

Studying GlpF-mediated transport in vitro requires careful consideration of several critical parameters:

  • Protein Purification and Reconstitution:

    • Express and purify recombinant GlpF using appropriate detergents that maintain protein structure and function.

    • Reconstitute purified GlpF into lipid vesicles (liposomes) with well-defined composition.

    • Estimate reconstitution efficiency using techniques like fluorescence correlation spectroscopy to enable accurate calculation of per-protein transport rates .

  • Transport Assay Conditions:

    • Transmembrane Potential: Consider the effect of transmembrane potential on GlpF permeability, as it can regulate water permeability .

    • Lipid Composition: Account for the impact of lipid bilayer asymmetry on GlpF function .

    • Temperature Control: Maintain consistent temperature during measurements to avoid variability in diffusion rates.

    • Osmotic Gradient: Establish well-defined osmotic gradients for water permeability measurements.

  • Measurement Techniques:

    • Stopped-Flow Spectroscopy: For rapid kinetic measurements of water or glycerol transport.

    • Light Scattering: To monitor vesicle volume changes in response to osmotic gradients.

    • Fluorescence-Based Assays: Using fluorescent probes sensitive to volume changes or substrate concentrations.

  • Data Analysis:

    • Apply appropriate mathematical models relating permeability coefficient (Pf) and water efflux from lipid vesicles .

    • Account for background permeability of the lipid bilayer itself.

    • Calculate single-channel permeability by normalizing to the number of functional GlpF molecules per vesicle.

By carefully controlling these parameters, researchers can obtain reliable in vitro measurements of GlpF-mediated transport that correlate with computational predictions and in vivo observations.

What are the most promising applications of recombinant GlpF research?

The study of recombinant GlpF has several promising applications in both fundamental research and biotechnology:

  • Enhanced Understanding of Spore Resistance and Germination: Further investigation of GlpF's role in spore germination could lead to improved methods for spore inactivation in food safety and other applications. The finding that spores lacking glpF are more susceptible to high-pressure inactivation suggests potential strategies for controlling bacterial spores in various contexts .

  • Protein Engineering for Biotechnology: The demonstrated ability to modulate water permeability through GlpF by modifying pore-lining residues opens possibilities for engineering membrane proteins with customized transport properties. These engineered variants could have applications in biosensors, water purification systems, or controlled release technologies .

  • Antimicrobial Drug Development: As GlpF plays essential roles in glycerol metabolism and potentially in spore germination, it represents a potential target for novel antimicrobial compounds that could disrupt these processes in pathogenic bacteria.

  • Model Systems for Studying Membrane Transport: The wealth of structural and functional data on GlpF makes it an excellent model system for studying fundamental aspects of facilitated diffusion across biological membranes, with implications for understanding similar processes in more complex organisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.