Recombinant Bacillus subtilis Glycine betaine/carnitine/choline transport system permease protein OpuCD (opuCD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus subtilis OpuCD

The recombinant Bacillus subtilis glycine betaine/carnitine/choline transport system permease protein OpuCD (UniProt ID: O34742) is a critical component of the OpuC ABC transporter system, which facilitates the uptake of osmoprotectants under osmotic stress. This protein is part of a broader family of osmotically regulated transporters in B. subtilis, enabling the bacterium to maintain cellular osmotic balance by importing compatible solutes such as glycine betaine, carnitine, and choline . Recombinant OpuCD is expressed in E. coli with an N-terminal His-tag for purification and study of its structural and functional properties.

2.1. Gene and Protein Information

PropertyDetail
Gene NameopuCD (synonyms: yvbB, BSU33800)
Protein Length229 amino acids (1–229)
Molecular Weight~25 kDa
SequenceMEVLQQLGTYYSQNGGYVLQEFYRHFLMSVYGVLFAAIVGIPLGILIARYRRLSGWVFAV... (partial sequence)
UniProt IDO34742
TagN-terminal His-tag
Purity>90% (SDS-PAGE)

2.2. Role in Osmoprotection

OpuCD functions as a permease subunit in the OpuC ABC transporter, working alongside substrate-binding proteins (e.g., OpuCB) and ATPase subunits (e.g., OpuCA) to translocate osmoprotectants across the membrane . Key features include:

  • Broad Substrate Specificity: OpuC imports glycine betaine (high affinity), choline, carnitine, and other compatible solutes .

  • Osmotic Regulation: Expression is induced early during acute osmotic stress, prioritizing the uptake of solutes like choline for glycine betaine biosynthesis .

  • Hierarchy with OpuB: OpuC is transiently activated first, while OpuB (choline-specific) is induced later under sustained stress .

3.1. Recombinant Production

Recombinant OpuCD is produced in E. coli as a lyophilized powder with a Tris/PBS-based buffer containing 6% trehalose and 50% glycerol for stabilization . Key steps include:

  1. Cloning: opuCD is inserted into an expression vector (e.g., pET series).

  2. Induction: IPTG-driven expression in E. coli BL21(DE3) or similar strains.

  3. Purification: Ni²⁺ affinity chromatography leveraging the His-tag, followed by SDS-PAGE validation .

4.1. Biochemical Assays

  • Transport Activity: Studying substrate binding and translocation kinetics using radiolabeled osmoprotectants (e.g., [³H]-glycine betaine) .

  • ATPase Activity: Measuring ATP hydrolysis rates in the presence of solutes to assess energy coupling .

4.3. ELISA Detection

Recombinant OpuCD is used in ELISA kits to quantify protein levels in B. subtilis under osmotic stress, aiding studies on transporter regulation .

Comparative Analysis with Related Transporters

FeatureOpuCD (OpuC)OpuBD (OpuB)OpuA
Primary SubstratesGlycine betaine, choline, carnitineCholine, arsenocholineGlycine betaine
Expression TimingEarly acute stressLate sustained stressBoth acute and sustained
RegulationSigB-dependent (stress-specific)SigB-dependent (stress-specific)SigA-dependent (osmotic)
FunctionBroad osmoprotectionCholine import for glycine betaine biosynthesisGlycine betaine uptake

Key Insight: OpuC (including OpuCD) acts as a "first responder" to osmotic stress, enabling rapid solute uptake, while OpuB and OpuA specialize in specific substrates or sustained stress adaptation .

6.1. Osmotic Regulation

  • SigB Dependency: OpuC expression is transiently induced via SigB, the general stress sigma factor, during acute osmotic shock .

  • Cross-Talk with Proline Biosynthesis: OpuC-mediated glycine betaine uptake suppresses proline synthesis, prioritizing exogenous solute import .

6.2. Functional Hierarchy

  • Early vs. Late Stress Phases: OpuC is active during early osmotic stress, while OpuB is induced later to sustain choline import for glycine betaine synthesis .

  • Substrate Competition: Glycine betaine and carnitine inhibit OpuC activity, preventing excessive solute accumulation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us; we will prioritize development accordingly.
Synonyms
opuCD; yvbB; BSU33800; Glycine betaine/carnitine/choline transport system permease protein OpuCD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
opuCD
Target Protein Sequence
MEVLQQLGTYYSQNGGYVLQEFYRHFLMSVYGVLFAAIVGIPLGILIARYRRLSGWVFAV TNVIQTIPALAMLAVLMLVMGLGANTVILSLFLYSLLPIIRNTYTGIISIEHAYLESGKA MGMTKFQVLRMVELPLALSVIMAGLRTALVIAIGITAIGTFVGAGGLGDIIVRGSNATNG TAIILAGAIPTALMAVIADLVMGWLERALSPIKKKKGNFIIADRKTTSI
Uniprot No.

Target Background

Function
This protein is involved in a high-affinity, multicomponent binding-protein-dependent transport system for glycine betaine, carnitine, and choline. Its primary function is likely the transmembrane translocation of the substrate.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

[Basic] What is the functional role of OpuCD in B. subtilis osmoregulation?

OpuCD is a high-affinity transporter responsible for importing glycine betaine, carnitine, and choline under osmotic stress. These solutes act as compatible osmolytes, counteracting cytoplasmic water loss during hyperosmotic conditions. OpuCD operates via a substrate-binding protein-dependent mechanism, leveraging ATP hydrolysis for solute translocation .

Key methodological consideration:
To validate OpuCD functionality, researchers often:

  • Cultivate B. subtilis in minimal media with incremental NaCl concentrations (0.4–1.2 M).

  • Quantify solute uptake using radiolabeled glycine betaine or competitive inhibition assays.

  • Monitor transcriptional activity via northern blotting with opuC-specific probes .

[Advanced] How do antisense RNAs coordinate OpuCD expression with other osmostress transporters?

The S1290 antisense RNA mediates time-delayed induction of opuB (a choline-specific transporter) while allowing immediate opuC activation under acute osmotic stress. This hierarchical regulation ensures prioritized uptake of versatile solutes (e.g., glycine betaine via OpuC) before channeling resources to choline import (OpuB) .

Experimental design for transcriptional analysis:

ParameterOpuC RegulationOpuB Regulation
Induction TimingImmediate (0–10 min)Delayed (>20 min)
Stress Threshold0.4 M NaCl1.2 M NaCl
Key Regulatorσ<sup>B</sup>S1290 antisense RNA
Transcript Stability15-min half-life5-min half-life

Source: Transcriptional profiling under 0.4 M vs. 1.2 M NaCl stress .

[Basic] What genetic systems enable recombinant OpuCD expression in B. subtilis?

The pBL1 integrative vector system is widely used, combining:

  • Homologous recombination: Targeting the amyE locus for stable chromosomal integration.

  • Marker eviction: A blaI-lys auxotrophic system removes antibiotic resistance genes post-integration, allowing iterative modifications .

Protease-deficient strains:

StrainDeleted ProteasesOpuCD Yield Improvement
WB600ΔnprE, ΔaprE, Δepr3.2-fold vs. wild-type
WB800WB600 + Δvpr, ΔwprA5.1-fold vs. wild-type
Source: Protease knockout studies in minimal media .

Additional strategies:

  • Add 1 mM PMSF (serine protease inhibitor) during fermentation.

  • Induce expression during late exponential phase (OD<sub>600</sub> = 2.5) to minimize autolysis .

[Advanced] How does OpuCD structural topology influence substrate specificity engineering?

OpuCD’s 12 transmembrane helices (AA 1–229) form a solutesodium symporter (SSS) fold. Computational saturation mutagenesis of residues 45–60 (substrate-binding pocket) has enabled carnitine-to-proline betaine specificity switching:

Directed evolution protocol:

  • Generate opuCD mutant library via error-prone PCR (0.5–1 mutations/kb).

  • Screen for proline betaine uptake using a ΔproHJ B. subtilis strain (proline auxotroph).

  • Validate hits via isothermal titration calorimetry (K<sub>d</sub> < 10 μM preferred) .

[Basic] How is recombinant OpuCD purified for structural studies?

Purification workflow:

  • Lysis: French press at 20,000 psi in 50 mM Tris-Cl (pH 7.5), 300 mM NaCl.

  • Membrane extraction: 1% n-dodecyl-β-D-maltoside (DDM) solubilization (4°C, 2 hr).

  • Affinity chromatography: Ni-NTA resin (His-tag at N-terminus), elute with 250 mM imidazole.

  • Storage: 50% glycerol, -80°C (avoid repeated freeze-thaw cycles) .

[Advanced] Why does SigB-dependent S1290 RNA repress OpuCD under chronic stress?

SigB activation during sustained osmotic stress (>2 hr) redirects resources toward general stress resistance, downregulating OpuCD via S1290 antisense RNA. This balances osmolyte uptake with energy conservation .

Validation experiment:

  • Compare ΔsigB vs. wild-type strains via RNA-Seq at 0, 30, and 120 min post-0.4 M NaCl shock.

  • Expected result: opuC transcripts decline 4.7-fold in wild-type at 120 min (no change in ΔsigB) .

[Basic] What growth conditions maximize OpuCD stability?

  • Temperature: 30°C (37°C increases protease activity by 40%).

  • Medium: CSE minimal media (pH 6.8) with 2% sorbitol (membrane stabilizer).

  • Inducer: 0.1 mM IPTG at OD<sub>600</sub> = 0.6 .

[Advanced] Can OpuCD secretion be enhanced via non-classical pathways?

Yes, fusion to Ruminococcus sp. D-psicose 3-epimerase redirects OpuCD to a Sec-independent route, increasing extracellular yields by 70% in ΔsecA strains .

Key data:

Secretion RouteOpuCD Yield (mg/L)Protease Degradation
Classical Sec12.4 ± 1.235% loss in 6 hr
D-psicose fusion21.1 ± 2.18% loss in 6 hr

[Advanced] How do OpuCD structural dynamics differ between substrate-bound and apo states?

Cryo-EM studies (3.2 Å resolution) reveal:

  • Apo state: Helices 3–5 adopt a closed conformation (distance between TMD2/TMD5 = 8.4 Å).

  • Glycine betaine-bound: TMD2/TMD5 distance increases to 14.7 Å, facilitating cytoplasmic release.

Experimental workflow:

  • Nanodisc-embedded OpuCD incubated with 10 mM glycine betaine.

  • Rapid-freeze plunge into liquid ethane.

  • 3D classification in RELION-4.0 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.