Recombinant Bacillus subtilis Holin-like protein CidA (cidA)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Bacillus subtilis Holin-like Protein CidA (cidA)

Recombinant Bacillus subtilis Holin-like protein CidA (cidA) is a bacterially expressed protein engineered to study its structural and functional roles in bacterial physiology. Produced in Escherichia coli with an N-terminal His tag, this 128-amino-acid full-length protein (UniProt ID: P39591) shares homology with holins—membrane proteins that regulate cell lysis and death .

Biological Function and Mechanism

CidA functions as a holin-like protein, modulating murein hydrolase activity and cell lysis in a manner analogous to bacteriophage holins . Key findings include:

Role in Cell Lysis and Biofilm Regulation

  • Murein Hydrolase Activation: CidA enhances extracellular murein hydrolase activity, promoting peptidoglycan degradation and penicillin sensitivity .

  • Antiholin Interaction: CidA operates antagonistically with LrgA (antiholin-like protein), forming a regulatory system for controlled cell lysis during biofilm development .

  • Biofilm Dynamics: CidA-mediated lysis facilitates extracellular DNA release, a critical component of biofilm matrices .

Holin-like Activity in Experimental Systems

  • E. coli Lysis Assays: Heterologous expression of CidA in E. coli supports bacteriophage endolysin-induced lysis, confirming pore-forming capability .

  • Liposome Leakage: Purified CidA induces carboxyfluorescein leakage in liposomes, demonstrating direct membrane disruption .

Experimental Use Cases

  • Cell Death Studies: Investigates programmed cell death mechanisms in Bacillus and Staphylococcus species .

  • Biofilm Research: Explores CidA’s role in biofilm maturation and structural integrity .

  • Antibiotic Sensitivity: Evaluates how CidA overexpression alters bacterial responses to β-lactam antibiotics .

Industrial and Therapeutic Potential

  • Biotechnological Tool: Utilized for controlled bacterial lysis in protein purification or metabolite release .

  • Antibiotic Adjuvant Development: Targeting CidA-LrgA interactions could enhance antibiotic efficacy against persistent infections .

Expression and Purification Protocols

Recombinant CidA is typically purified via immobilized metal affinity chromatography (IMAC) due to its His tag . Critical considerations include:

  • Reconstitution: Dissolve lyophilized protein in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for stability .

  • Storage: Aliquot at -20°C/-80°C to prevent freeze-thaw degradation .

Comparative Analysis with Homologs

FeatureCidA (B. subtilis)LrgA (S. aureus)
FunctionPro-lytic holinAnti-lytic antiholin
Operon RegulationMaximally expressed in early exponential phase Induced during stationary phase
Impact on BiofilmPromotes DNA release Inhibits premature lysis

Challenges and Future Directions

While CidA’s holin-like activity is well-established, its endogenous regulation in B. subtilis remains less characterized compared to S. aureus homologs . Future studies may explore:

  • Structural Resolution: Cryo-EM or X-ray crystallography to map pore-forming domains.

  • Metabolic Coupling: Investigating links between CidA and overflow metabolism (e.g., acetate/acetoin synthesis) .

  • In Vivo Dynamics: Real-time imaging of CidA oligomerization during lysis events.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request as closely as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotation at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
cidA; ywbH; BSU38320; ipa-23r; Holin-like protein CidA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
cidA
Target Protein Sequence
MKKLLLTVIQIALLFIFARLINWVTALLHINIPGSIIGIVILFTLLHFNIIKLEWIELGA AWLLGELLLFFIPSAVGVIEYGDIMSKFGVSILLVVIISTFVVMVSTGTLTQLIAKRKEK KHTCSSEL
Uniprot No.

Target Background

Function
CidA enhances the activity of extracellular murein hydrolases by potentially facilitating their export through hole formation. Its function is inhibited by the antiholin-like proteins LrgAB. In unstressed cells, LrgAB products likely suppress CidA's activity. When cells experience stress, such as antibiotic exposure or environmental factors, CidA possibly oligomerizes within the bacterial cell membrane, creating lesions that disrupt the proton motive force, leading to cell death. These lesions are also hypothesized to regulate subsequent cell lysis by either allowing murein hydrolases access to the cell wall substrate or by influencing their activity through a potential change in cell wall pH resulting from membrane potential loss.
Database Links
Protein Families
CidA/LrgA family, CidA subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus subtilis Holin-like protein CidA and what are its basic characteristics?

Bacillus subtilis Holin-like protein CidA (cidA) is a 128-amino acid protein that functions as a murein hydrolase regulator. The protein has several identified synonyms in research literature including ywbH, BSU38320, and ipa-23r . The full amino acid sequence is: MKKLLLTVIQIALLFIFARLINWVTALLHINIPGSIIGIVILFTLLHFNIIKLEWIELGAAWLLGELLLFFIPSAVGVIEYGDIMSKFGVSILLVVIISTFVVMVSTGTLTQLIAKRKEKKHTCSSEL .

Based on structural analysis, CidA proteins are considered holin-like proteins that may form pores in the cytoplasmic membrane, contributing to the regulation of cell wall degradation and autolysis processes. The protein has a UniProt ID of P39591 and is often studied in the context of bacterial programmed cell death mechanisms .

How does cidA differ between Bacillus subtilis and other bacterial species like Staphylococcus aureus?

While both Bacillus subtilis and Staphylococcus aureus possess cidA genes that encode holin-like proteins, their functions show both similarities and species-specific differences:

FeatureB. subtilis cidAS. aureus cidA
Size128 amino acids Similar size range
FunctionHolin-like protein, likely involved in cell lysis regulationMurein hydrolase regulator, contributes to DNA release and biofilm formation
Experimental evidenceLimited data on biofilm effectsShown to affect cell lysis during planktonic growth and biofilm development
Mutant phenotypeNot well documented in search resultscidA mutants display decreased extracellular murein hydrolase activity, reduced stationary-phase lysis, and impaired biofilm formation

In S. aureus, cidA-controlled cell lysis plays a significant role during biofilm development, and the released genomic DNA serves as an important structural component of the biofilm matrix . Similar functions may exist in B. subtilis, though direct experimental evidence comparing the two species' cidA functions would require further investigation.

What is the proposed mechanism of action for cidA in bacterial programmed cell death and how can researchers effectively study this process?

The cidA gene is proposed to encode components of a bacterial programmed cell death and lysis mechanism . For researchers studying this process, the following methodological approaches are recommended:

  • Genetic manipulation approaches: Generate cidA knockout mutants using allelic replacement or CRISPR-Cas9 techniques. Compare these mutants with wild-type strains under various stress conditions to evaluate differences in cell lysis patterns.

  • Cell death assessment methods: Use dual fluorescent staining (e.g., SYTO 9/propidium iodide) to distinguish between live and dead cells within bacterial populations. Flow cytometry can provide quantitative data on population heterogeneity.

  • Molecular detection of lysis: Measure the release of intracellular markers like β-galactosidase into culture supernatants as an indicator of cell lysis, as demonstrated in studies with S. aureus cidA mutants .

  • Membrane potential analysis: Since holin-like proteins typically affect membrane integrity, membrane potential measurements using voltage-sensitive dyes can help characterize cidA's effects.

It's important to note that while cidA's role in programmed cell death has been proposed, the complete biological significance and regulatory mechanisms remain areas of active investigation requiring multifaceted experimental approaches.

How does recombinant cidA protein expression differ when comparing various expression systems and optimization strategies?

Researchers have several options for recombinant cidA expression, each with distinct advantages and limitations:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coli (as in search results)Well-established protocols, high yield potential, N-terminal His tag enables efficient purification Potential toxicity due to membrane-targeting nature of holin-like proteinsUse tightly controlled inducible promoters; express at lower temperatures (16-25°C)
B. subtilisNative environment may preserve natural folding and modificationsMore complex genetic manipulation than E. coliOptimize codon usage; use secretion vectors if toxicity is observed
Cell-free expressionAvoids toxicity issues that may arise in living cellsLower yields, higher costSupplement with membrane mimetics for proper folding

For the E. coli expression system documented in the search results, the recombinant protein includes the full-length cidA (1-128aa) with an N-terminal His tag . After expression, the protein is purified to greater than 90% as determined by SDS-PAGE . Researchers should consider that membrane proteins like cidA may require careful optimization of induction conditions, temperature, and extraction methods to maximize functional yield.

What are the optimal conditions for storage and reconstitution of recombinant cidA protein to maintain its structural integrity and activity?

Based on experimental data, the following protocol is recommended for optimal storage and reconstitution of recombinant cidA:

Storage conditions:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended default is 50%) for long-term storage

  • For storage buffer, a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 has been effectively used

What technical challenges arise when designing functional assays for cidA, and how can these be addressed?

Designing functional assays for cidA presents several technical challenges due to its membrane-associated nature and role in cell death processes:

  • Membrane integration assessment:

    • Challenge: Confirming proper membrane insertion of the recombinant protein

    • Solution: Use fluorescent fusion proteins combined with confocal microscopy or membrane fractionation followed by Western blotting

  • Pore formation activity:

    • Challenge: Directly measuring the pore-forming ability of cidA

    • Solution: Liposome leakage assays with encapsulated fluorescent dyes or electrophysiological measurements using planar lipid bilayers

  • Cell lysis regulation:

    • Challenge: Distinguishing cidA's direct effects from downstream consequences

    • Solution: Complementation studies in cidA mutants with controlled expression of wild-type or modified recombinant cidA

  • Interaction with murein hydrolases:

    • Challenge: Determining specific protein-protein interactions

    • Solution: Co-immunoprecipitation, bacterial two-hybrid assays, or surface plasmon resonance with purified components

When designing these assays, researchers should include appropriate controls such as heat-inactivated protein, mutant versions of cidA with altered key residues, and comparative analyses with homologous proteins from other bacterial species.

How can cidA research inform our understanding of biofilm formation and potential anti-biofilm strategies?

Research on S. aureus has demonstrated that cidA-controlled cell lysis plays a significant role in biofilm development, with released genomic DNA serving as an important structural component of the biofilm matrix . This finding suggests several research directions for B. subtilis cidA:

  • Comparative biofilm analysis:

    • Generate B. subtilis cidA mutants and assess biofilm formation quantitatively and qualitatively

    • Compare extracellular DNA (eDNA) content in wild-type versus mutant biofilms

    • Evaluate the effect of DNase treatment on biofilm stability

  • Potential anti-biofilm applications:

    • Testing cidA inhibitors as anti-biofilm agents

    • Development of strategies targeting cidA-mediated eDNA release

    • Combination approaches targeting both protein function and biofilm matrix components

In S. aureus studies, cidA mutant biofilms exhibited a rougher appearance compared with the parental strain and were less adherent . Additionally, quantitative real-time PCR experiments demonstrated the presence of 5-fold less genomic DNA in the cidA mutant biofilm relative to the wild type . Treatment of wild-type biofilms with DNase I caused extensive cell detachment, whereas similar treatment of the cidA mutant biofilm had only a modest effect . These findings suggest that targeting cidA function could be a viable approach to controlling biofilm formation in multiple bacterial species.

What role might cidA play in bacterial response to antimicrobials, and how can this be experimentally investigated?

As a protein involved in bacterial cell lysis and death pathways, cidA may significantly impact antimicrobial susceptibility and resistance development. Researchers can investigate this relationship through:

  • Susceptibility testing protocols:

    • Compare minimum inhibitory concentrations (MICs) of various antibiotics against wild-type and cidA mutant strains

    • Evaluate the rate of killing by time-kill assays to assess differences in bactericidal activity

    • Examine post-antibiotic effect duration in the presence or absence of functional cidA

  • Stress response analysis:

    • Monitor cidA expression levels in response to sub-lethal antibiotic exposure using qRT-PCR or reporter gene fusions

    • Assess whether pre-activation or inhibition of cidA pathways alters subsequent antibiotic susceptibility

    • Investigate potential cross-talk between cidA regulation and known antibiotic resistance mechanisms

  • Persister cell formation:

    • Determine if cidA affects the formation of antibiotic-tolerant persister cells

    • Evaluate whether cidA mutants show altered persister frequencies under various stress conditions

    • Investigate the molecular mechanisms connecting cidA function to persistence phenotypes

This research direction is particularly relevant given the increasing concern about antimicrobial resistance and the need for novel therapeutic targets. Establishing connections between cell death pathways and antibiotic efficacy could reveal new combination strategies to enhance existing antimicrobials.

What controls and experimental design factors should be considered when studying cidA function in different bacterial species?

When designing experiments to study cidA function across different bacterial species, researchers should implement the following controls and experimental design considerations:

  • Genetic controls:

    • Include both positive (wild-type) and negative (complete gene deletion) controls

    • Use complementation strains where the mutant has the wild-type gene reintroduced to verify phenotype specificity

    • Consider using point mutations in key functional domains as additional controls

  • Physiological variables to control:

    • Growth phase: cidA effects may be growth-phase dependent, particularly in stationary phase when lysis typically occurs

    • Media composition: nutrient availability may affect cidA expression and function

    • Environmental stress: temperature, pH, osmolarity, and oxygen availability

  • Cross-species considerations:

    • Account for different genetic backgrounds when comparing cidA function between species

    • Consider synteny and genetic context of cidA in different organisms

    • Validate antibodies or detection methods across species due to potential sequence variations

  • Quantitative measurements:

    • Use multiple, complementary methods to assess cell lysis (e.g., optical density, viable counts, enzyme release assays)

    • Implement appropriate statistical analyses for biological replicates

    • Consider population heterogeneity by including single-cell analyses when possible

What are the most promising future research directions for cidA and related bacterial cell death mechanisms?

The study of cidA and related bacterial cell death mechanisms presents several promising research avenues:

  • Structural biology approaches:

    • Determination of cidA's three-dimensional structure to understand its membrane integration and pore formation mechanism

    • Structure-guided design of specific inhibitors or modulators of cidA function

  • Systems biology integration:

    • Comprehensive mapping of the cidA regulon across different bacterial species

    • Integration of transcriptomic, proteomic, and metabolomic data to understand the broader impact of cidA-mediated processes

  • Host-pathogen interaction studies:

    • Investigation of how cidA-mediated eDNA release affects host immune recognition

    • Exploration of cidA's potential role in horizontal gene transfer during infection

  • Therapeutic applications:

    • Development of anti-biofilm strategies targeting cidA-dependent processes

    • Evaluation of cidA modulators as antibiotic adjuvants to enhance treatment efficacy

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.