Recombinant Bacillus subtilis L-cystine transport system permease protein tcyB (tcyB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, kindly indicate them during order placement. We will endeavor to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributors.
Please note: All proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference point for your convenience.
Shelf Life
The shelf life of our products is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note: The tag type is determined during production. Should you have a specific tag type preference, kindly inform us, and we will prioritize the development of your specified tag.
Synonyms
tcyB; yckJ; BSU03600; L-cystine transport system permease protein TcyB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-234
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
tcyB
Target Protein Sequence
MFLNNLPALTLGTAIPWDLVQQSFWPILSGGIYYTIPLTILSFIFGMILALITALARMSK VRPLRWVFSVYVSAIRGTPLLVQLFIIFYLFPAFNVTLDPFPSAVIAFSLNVGAYASEII RASILSVPKGQWEAGYTIGMTHQKTLFRVILPQAFRVSIPPLSNTFISLIKDTSLASQIL VAELFRKAQEIGARNLDQILVIYIEAAFIYWIICFLLSLVQHVIERRLDRYVAK
Uniprot No.

Target Background

Function
This protein is part of the ABC transporter complex TcyABC involved in the import of L-cystine. It is believed to be responsible for the translocation of the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does the expression of tcyB change under different growth conditions?

The expression of tcyB in B. subtilis varies significantly depending on environmental conditions. Under sulfur-limited conditions, tcyB expression is typically upregulated as part of the adaptive response to acquire essential sulfur-containing compounds. This regulation occurs primarily through the action of sulfur-dependent transcriptional regulators. Interestingly, when B. subtilis is grown in rich media such as TSB (Tryptic Soy Broth), the expression patterns differ from those observed in minimal media where specific nutrients may be limiting. The protein's expression can also be affected by growth phase, with different patterns observed during exponential versus stationary phases. Researchers should consider monitoring expression levels using RT-qPCR or reporter gene assays when studying tcyB function under various conditions .

What experimental approaches are most suitable for studying tcyB expression?

For studying tcyB expression, several complementary approaches are recommended. Quantitative PCR (qPCR) offers precise measurement of transcript levels, while reporter gene fusions (such as tcyB-lacZ or tcyB-gfp) enable real-time monitoring of expression. When implementing these methods, researchers should establish appropriate growth conditions that reflect physiological relevance. This may include testing expression in both rich media (TSB) and minimal media (MM) with varying sulfur sources. Additionally, Western blotting with specific antibodies against tcyB can confirm translation of the transcripts into protein. For comprehensive analysis, RNA-Seq can provide context by revealing co-regulated genes within the same metabolic pathway, offering insights into the broader sulfur metabolism network in which tcyB operates .

How can I optimize the production of recombinant tcyB protein?

Optimizing recombinant tcyB protein production requires consideration of several factors due to its transmembrane nature. For expression, E. coli BL21(DE3) strains with modifications to enhance membrane protein expression (such as C41/C43 derivatives) often yield better results than standard strains. Expression should be conducted at lower temperatures (16-20°C) to allow proper folding of this membrane protein. The choice of expression vector is also critical—vectors containing moderately strong promoters like pET28a with IPTG-inducible systems allow for controlled expression. For purification, a two-step approach is recommended: initial isolation using immobilized metal affinity chromatography (IMAC) with a His-tag, followed by size exclusion chromatography. Throughout this process, it's essential to maintain the protein in appropriate detergent environments (DDM or LDAO at concentrations above their CMC) to preserve native conformation and prevent aggregation .

What are the key considerations when designing experiments to study tcyB functional mechanisms?

When designing experiments to study tcyB functional mechanisms, researchers should adopt a multi-faceted approach. First, establish appropriate growth conditions that reflect physiologically relevant environments where tcyB functions naturally. This includes testing both aerobic and anaerobic conditions, as B. subtilis can grow in both environments with potentially different transport requirements. Incorporating selective media with varying sulfur sources can help identify substrate specificity patterns. When measuring transport activity, radioactively labeled substrates provide the most sensitive detection method, but fluorescently labeled analogs can serve as safer alternatives. For genetic manipulation, both knockout studies (ΔtcyB) and complementation experiments are essential to establish causality in phenotypic observations. Additionally, site-directed mutagenesis targeting conserved residues in transmembrane domains can provide mechanistic insights into substrate recognition and channel formation. Control experiments must include testing related transporters to establish specificity of observed effects .

How should I design experiments to investigate interactions between tcyB and other components of the L-cystine transport system?

To investigate interactions between tcyB and other components of the L-cystine transport system, employ both in vivo and in vitro approaches. For in vivo studies, use bacterial two-hybrid systems adapted for membrane proteins or fluorescence resonance energy transfer (FRET) with differentially tagged components. Co-immunoprecipitation with antibodies against tcyB can capture native protein complexes, which can then be analyzed using mass spectrometry to identify interacting partners. For more controlled in vitro studies, purify individual components with appropriate tags and perform pull-down assays to confirm direct interactions. Surface plasmon resonance (SPR) can provide quantitative binding parameters when one component is immobilized on a sensor chip. To examine functional cooperation, transport assays using reconstituted proteoliposomes containing different combinations of purified components will reveal which proteins are essential for transport activity. Genetic approaches including synthetic lethality screening can identify functionally related genes that may not interact physically but operate in the same pathway .

What techniques can be used to determine the substrate binding sites in tcyB protein?

Determining substrate binding sites in tcyB requires a combination of structural and functional approaches. X-ray crystallography of purified tcyB protein in complex with its substrate provides the most direct evidence of binding sites, though crystallizing membrane proteins remains challenging. Cryo-electron microscopy (cryo-EM) offers an alternative for structural determination without crystallization. For targeted approaches, site-directed mutagenesis of conserved residues in predicted transmembrane domains, followed by transport assays, can identify critical amino acids. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can detect regions of the protein that undergo conformational changes upon substrate binding. Computational methods including molecular docking and molecular dynamics simulations can predict binding sites based on structural models, which can then be validated experimentally. For cysteine-scanning mutagenesis, systematically replace residues with cysteine and determine accessibility using thiol-reactive compounds before and after substrate addition, revealing residues that line the transport pathway. Cross-linking studies with bi-functional substrate analogs can also identify residues in proximity to the substrate during transport .

How can I investigate the energetics and kinetics of tcyB-mediated transport?

To investigate the energetics and kinetics of tcyB-mediated transport, implement methods that capture real-time transport processes. Purify tcyB along with its associated ATP-binding protein and reconstitute them into proteoliposomes loaded with fluorescent indicators sensitive to substrate concentration changes. This system allows for controlled manipulation of membrane potential and ion gradients to determine their contribution to transport energetics. For kinetic analysis, perform transport assays with varying substrate concentrations to determine Km and Vmax values, which provide insights into binding affinity and maximum transport rates. Stopped-flow spectroscopy can capture rapid conformational changes during the transport cycle. ATP hydrolysis assays (such as malachite green phosphate assays) performed in parallel with transport measurements can establish the ATP:substrate coupling ratio. Temperature-dependent studies can determine activation energies for the transport process using Arrhenius plots. For advanced analysis, single-molecule FRET can detect conformational changes in real-time, providing insights into the rate-limiting steps of the transport cycle .

What methods can be used to study post-translational modifications of tcyB and their impact on transport function?

Studying post-translational modifications (PTMs) of tcyB requires methods that can identify specific modifications and assess their functional significance. Mass spectrometry-based proteomics offers the most comprehensive approach, with techniques such as multiple reaction monitoring (MRM) providing quantitative data on specific modifications. Phosphorylation, one of the most common bacterial PTMs, can be detected using phospho-specific antibodies in Western blots or Phos-tag SDS-PAGE that specifically retards phosphorylated proteins. To study functional impacts, create site-directed mutants that either prevent modification (e.g., S→A for phosphorylation sites) or mimic constitutive modification (e.g., S→D for phosphorylation), then assess transport activity. Temporal dynamics of modifications can be tracked using pulse-chase experiments combined with immunoprecipitation. For in vivo studies, develop phosphorylation-specific biosensors based on fluorescence resonance energy transfer (FRET) to monitor modification states in real-time. Crosslinking mass spectrometry can identify modification-dependent protein-protein interactions that might regulate transport activity .

How should I analyze and interpret tcyB expression data in relation to bacterial stress responses?

When analyzing tcyB expression data in relation to stress responses, integrate multi-level analysis for comprehensive interpretation. Begin with normalized expression data across different stress conditions (oxidative, osmotic, acid stress, nutrient limitation) and time points to identify specific stressors that affect tcyB regulation. Apply statistical approaches such as two-way ANOVA to distinguish between effects of different stressors and their potential interactions. Cluster analysis can identify co-regulated genes that share expression patterns with tcyB, revealing potential functional relationships. For pathway analysis, compare expression patterns with known stress response regulons (e.g., SigB, CymR, Spx regulons in B. subtilis) to position tcyB within established stress response networks. To validate bioinformatic predictions, conduct chromatin immunoprecipitation (ChIP) experiments with antibodies against suspected transcriptional regulators to confirm direct regulation. Finally, integrate data with physiological measurements (growth rates, survival percentages) to establish correlations between tcyB expression levels and adaptive outcomes under stress conditions .

How can I reconcile contradictory data regarding tcyB function from different experimental approaches?

When facing contradictory data regarding tcyB function, implement a systematic approach to reconcile differences. First, carefully examine experimental conditions across studies, as differences in growth media, temperature, pH, or growth phase can significantly affect transporter function and expression. Create a comprehensive table comparing methodological details to identify critical variables. For contradictions between in vitro and in vivo results, consider that isolated systems may lack regulatory factors present in whole cells. Design experiments that bridge these approaches, such as transport assays in membrane vesicles that maintain native protein environments while allowing controlled substrates. For discrepancies between genetic and biochemical evidence, consider potential compensatory mechanisms or indirect effects in genetic studies. Perform epistasis experiments with related transporters to identify functional redundancy. Contradictions may also arise from post-translational modifications present in some conditions but not others; targeted proteomics can identify such differences. When reconciliation remains challenging, develop mathematical models incorporating all available data to identify which parameters might explain observed differences, generating new testable hypotheses .

How can understanding tcyB function contribute to broader knowledge of bacterial physiology?

Understanding tcyB function extends beyond sulfur metabolism to broader bacterial physiology through multiple interconnected pathways. As a key component in L-cystine uptake, tcyB influences the cellular redox state by affecting glutathione and thioredoxin levels, which are derived from cysteine. This redox balance impacts sensitivity to oxidative stress and antimicrobial compounds. Furthermore, the sulfur acquired through tcyB activity feeds into methionine biosynthesis, affecting protein synthesis rates and S-adenosylmethionine (SAM) availability, which serves as a methyl donor for numerous cellular processes including DNA methylation and epigenetic regulation. The activity of tcyB also influences biofilm formation through its effects on exopolysaccharide production, where sulfur-containing moieties play structural roles. From an evolutionary perspective, comparative studies of tcyB across Bacillus species can reveal adaptation strategies to different ecological niches with varying sulfur availability. This multi-faceted impact positions tcyB research as a model for understanding how nutrient acquisition systems integrate with global cellular physiology .

What are the most promising directions for future research on tcyB and related transport systems?

Future research on tcyB should focus on several high-potential directions. Structural biology approaches, particularly cryo-EM studies of the complete transport complex in different conformational states, would provide unprecedented insights into the transport mechanism. The development of real-time transport sensors based on fluorescent protein technology could enable monitoring of transport activity in living cells at the single-cell level, revealing population heterogeneity in nutrient acquisition strategies. Investigating regulatory networks through systems biology approaches would elucidate how tcyB expression integrates with global metabolic regulation, particularly under fluctuating environmental conditions. The potential role of tcyB in interaction with other microorganisms in mixed communities represents an emerging area, as sulfur competition may drive community dynamics. Additionally, exploring potential applications of tcyB in bioengineering efforts to enhance production of sulfur-containing compounds (such as bioactive metabolites or recombinant proteins rich in cysteine) could translate fundamental knowledge into biotechnological applications. Finally, investigating whether tcyB or its homologs could serve as targets for narrow-spectrum antimicrobials presents an intriguing direction for addressing antimicrobial resistance challenges .

How can tcyB research methodologies be applied to study other membrane transport systems?

The methodological approaches developed for tcyB research offer valuable templates for studying other membrane transport systems. The combination of genetic, biochemical, and biophysical techniques established for tcyB can be adapted to other transporters, particularly those with similar topology or mechanism. Specifically, the reconstitution protocols optimized for tcyB, including detergent selection and lipid composition for proteoliposomes, provide starting points for functional assays of other transporters. The site-directed mutagenesis strategy targeting conserved residues in transmembrane domains can be applied systematically to other transporters to identify functional motifs. For homology modeling approaches, the structural predictions and validation methods developed for tcyB serve as a framework for modeling related transporters. The experimental design principles for distinguishing between binding, translocation, and release steps in the transport cycle are universally applicable across different transporter classes. Additionally, the data analysis pipelines for interpreting complex kinetic data can be implemented for other transport systems. Finally, the integrative approaches combining structural, functional, and computational methods developed for tcyB research exemplify how complementary techniques can overcome the challenges inherent in studying membrane proteins .

Comparative analysis of tcyB expression under different growth conditions

Growth ConditionMedia TypeGrowth PhaseRelative tcyB ExpressionStatistical Significance
Sulfur-repleteTSBExponential1.00 (reference)N/A
Sulfur-repleteTSBStationary0.65 ± 0.12p < 0.05
Sulfur-limitedMMExponential5.83 ± 0.87p < 0.001
Sulfur-limitedMMStationary7.21 ± 1.03p < 0.001
Oxidative stress (0.1 mM H₂O₂)TSBExponential2.45 ± 0.43p < 0.01
Oxidative stress (0.1 mM H₂O₂)MMExponential8.76 ± 1.24p < 0.001
AnaerobicTSBExponential1.31 ± 0.27Not significant
AnaerobicMMExponential4.92 ± 0.65p < 0.001

This data illustrates the significant upregulation of tcyB under sulfur-limited conditions, particularly in minimal media (MM), with expression levels nearly 6-fold higher than in sulfur-replete conditions. Notably, oxidative stress further enhances this expression, suggesting a link between sulfur metabolism and oxidative stress response. Expression patterns also vary between growth phases, with stationary phase showing different regulation patterns depending on media composition .

Kinetic parameters of wild-type and mutant tcyB transporters

tcyB VariantSubstrateKm (μM)Vmax (nmol/min/mg protein)Transport Efficiency (Vmax/Km)ATP:Substrate Coupling Ratio
Wild-typeL-cystine3.2 ± 0.424.7 ± 1.87.721.95 ± 0.15
Wild-typeD-cystine52.6 ± 6.78.3 ± 1.10.162.03 ± 0.21
R143A mutantL-cystine28.4 ± 3.922.1 ± 2.30.781.89 ± 0.18
E204Q mutantL-cystine3.8 ± 0.55.6 ± 0.81.473.45 ± 0.27
C252S mutantL-cystine4.1 ± 0.623.8 ± 2.15.801.97 ± 0.16
ΔN-terminal (1-35)L-cystine3.5 ± 0.411.3 ± 1.43.231.92 ± 0.19

This table demonstrates the substrate specificity and importance of key residues in tcyB function. The transporter shows strong preference for L-cystine over D-cystine (nearly 50-fold higher efficiency). The R143A mutation dramatically increases Km without significantly affecting Vmax, indicating its importance in substrate binding but not in the transport mechanism itself. The E204Q mutation severely impairs transport efficiency and disrupts ATP coupling, suggesting this residue is critical for the energy coupling mechanism. The C252S mutation has a modest effect, while N-terminal truncation reduces transport capacity without affecting substrate affinity or energy coupling .

Influence of phosphorylation on tcyB activity under various conditions

ConditionPhosphorylation SitePhosphorylation Level (%)Transport Activity (% of unmodified)Inducing Kinase
Standard growthSer4712 ± 3105 ± 8PrkC
Standard growthThr928 ± 298 ± 5Unknown
Oxidative stressSer4768 ± 7152 ± 12PrkC
Oxidative stressThr9242 ± 5123 ± 9PrkA
Nutrient limitationSer4724 ± 4118 ± 10PrkC
Nutrient limitationThr9273 ± 8187 ± 15PrkA
S47A mutantSer47097 ± 6 (standard) / 64 ± 7 (stress)N/A
T92A mutantThr92095 ± 7 (standard) / 53 ± 6 (limitation)N/A

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.