Recombinant Bacillus subtilis Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format preference, please indicate it in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
lspA; lsp; BSU15450; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
lspA
Target Protein Sequence
MLYYMIALLIIAADQLTKWLVVKNMELGQSIPIIDQVFYITSHRNTGAAWGILAGQMWFF YLITTAVIIGIVYYIQRYTKGQRLLGVALGLMLGGAIGNFIDRAVRQEVVDFIHVIIVNY NYPIFNIADSSLCVGVMLLFIQMLLDSGKKKKEQ
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein Signal Peptidase (lspA) in Bacillus subtilis?

Lipoprotein signal peptidase (lspA) is an essential membrane-bound enzyme that processes prolipoproteins in B. subtilis by cleaving their signal peptides. It belongs to the aspartyl protease family and specifically recognizes the lipobox sequence [L(VI)−3-A(STVI)−2-G(AS)−1-C*+1], cleaving between the glycine and cysteine residues. Computer-assisted analyses indicate that B. subtilis contains approximately 114 genes encoding lipoproteins that are retained in the cytoplasmic membrane after processing by lspA . This enzyme has no mammalian equivalents, making it particularly interesting as an antimicrobial target.

What is the biological significance of lspA in B. subtilis?

The lspA enzyme is critical for proper cell function across various conditions. Research demonstrates that lipoprotein processing is particularly important for cell viability at both low and high temperatures, suggesting that properly processed lipoproteins are essential for growth under these stress conditions . Interestingly, while certain lipoproteins are known to be required for competence development, sporulation, and germination, these developmental processes were not significantly affected in the absence of SPase II in experimental models . This suggests complex compensatory mechanisms or redundancy in these pathways.

How does B. subtilis lspA relate to the intestinal life cycle of this bacterium?

Recent research has revealed that B. subtilis, traditionally considered a soil organism, has an intestinal life cycle. Studies using reverse transcription-PCR have documented significant levels of germination and sporulation in the mouse gut following oral administration of spores . This finding suggests that spores are not merely transient passengers of the gastrointestinal tract but have adapted to complete their entire life cycle within this environment. As lspA processes lipoproteins potentially involved in germination and colonization, it may play an indirect role in this newly discovered intestinal life cycle of B. subtilis .

What expression systems are most effective for recombinant B. subtilis lspA?

When working with recombinant lspA, researchers should consider membrane protein expression systems that maintain the native conformation of this integral membrane protein. Based on structural studies of similar enzymes, expression in E. coli using vectors with inducible promoters and appropriate signal sequences has proven effective. Temperature control during expression is critical, as lower temperatures (16-20°C) often reduce inclusion body formation. Fusion tags such as His6 at either the N- or C-terminus can facilitate purification while preserving enzyme activity, though care must be taken as tags may affect membrane insertion or folding.

What purification strategies yield functional recombinant lspA?

Purification of active lspA requires specialized approaches due to its membrane-embedded nature. A typical protocol involves:

  • Membrane fraction isolation through differential centrifugation

  • Solubilization using mild detergents (commonly DDM or LDAO)

  • Immobilized metal affinity chromatography (IMAC) utilizing engineered His-tags

  • Size exclusion chromatography for final purification

  • Reconstitution into lipid nanodiscs or liposomes to maintain native conformation

The choice of detergent is particularly crucial, as it must effectively solubilize the enzyme while preserving its structural integrity and catalytic activity.

What experimental designs are suitable for studying lspA function?

When designing experiments to study lspA function, researchers can choose from several methodological approaches:

  • Repeated Measures Design: This approach uses the same bacterial strains across different conditions (e.g., with various inhibitors or substrates). This design eliminates strain-to-strain variation but risks order effects, which can be mitigated through counterbalancing .

  • Independent Groups Design: Different bacterial strains (e.g., wild-type vs. lspA knockout) are subjected to specific conditions. While this eliminates order effects, it introduces potential strain-specific variables .

  • Matched Pairs Design: Similar strains are matched based on relevant characteristics before experimental treatment, balancing the strengths and weaknesses of the other approaches .

The choice depends on the specific research question, available resources, and the need to control for particular variables.

What assays can quantify B. subtilis lspA activity?

Several complementary assays have been developed to measure lspA activity:

  • FRET-based Assays: Fluorescence resonance energy transfer assays using synthetic peptide substrates (such as Abz-LALAGC*SS-nY-NH2) allow continuous monitoring of enzymatic activity. Upon cleavage, the fluorophore and quencher are separated, resulting in increased fluorescence .

  • Gel-shift Assays: These utilize prolipoprotein substrates (like proICP) and detect the mobility shift between precursor and processed forms on SDS-PAGE .

  • Mass Spectrometry: LC-MS/MS can identify and quantify the products of lspA-mediated cleavage with high precision.

When implementing FRET assays, it's essential to create calibration curves using purified products to convert fluorescence changes into molar quantities. Additionally, researchers should verify that inner filter effects don't interfere with measurements by ensuring sample absorbance values at excitation and emission wavelengths remain low (typically below 0.08) .

How should inhibition studies be designed and analyzed?

For inhibition studies with compounds like globomycin or myxovirescin:

  • Determine appropriate concentration ranges through preliminary experiments

  • Generate dose-response curves using varying inhibitor concentrations

  • Calculate IC50 values using appropriate software (e.g., Prism from GraphPad)

  • Incorporate proper controls, including known inhibitors as positive controls

  • Consider enzyme-inhibitor pre-incubation time as a variable that may affect results

When comparing inhibitor potency across different assay systems or enzyme sources, it's crucial to maintain consistent experimental conditions and analyze data using the same methodological approach.

What is known about the structural features of lspA?

Structural studies of LspA from S. aureus (LspMrs) provide insights that likely apply to B. subtilis LspA due to conservation among bacterial species. Key structural features include:

  • Membrane-embedded topology with accessible active site

  • Catalytic dyad of aspartate residues essential for peptide bond hydrolysis

  • Substrate binding pocket that accommodates both the signal peptide and the lipid-modified cysteine

  • β-cradle structure that helps position the acyl chains of the diacylglyceryl-modified cysteine

Crystal structures of LspA complexes with inhibitors reveal important details about binding interactions, as shown in the following table:

FeatureLspMrs-globomycin (6RYO)LspMrs-myxovirescin (6RYP)
Space groupP3 221P6 122
Cell dimensions (a, b, c in Å)52.3, 52.3, 135.954.2, 54.2, 317.5
Resolution (Å)45.26–1.9246.40–2.30
R.m.s. bond lengths (Å)0.0020.001
B-factor (Protein)36.7868.15
B-factor (Inhibitor)20.8775.61
Ramachandran favored (%)97.3998.15

These high-resolution structures provide valuable templates for understanding the B. subtilis enzyme .

How do inhibitors like globomycin and myxovirescin interact with lspA?

Globomycin and myxovirescin are structurally distinct natural antibiotics that both inhibit lspA, but through different binding modes:

  • Globomycin: This cyclic peptide mimics the lipobox sequence of the natural substrate. Its Ser-g.Leu-g.Ile-g.Ser sequence likely corresponds to the substrate lipobox. It approaches the binding site from one side of the substrate-binding pocket .

  • Myxovirescin (also known as antibiotic TA or megovalicin): This 28-membered macrolactam lactone has a completely different chemical structure from globomycin. Despite extensive efforts, attempts at generating a crystal structure with P. aeruginosa LspA failed, but structures with S. aureus LspA were obtained. Interestingly, myxovirescin approaches the binding site from the opposite side compared to globomycin .

Despite their different approaches, both inhibitors block the catalytic dyad essential for enzymatic activity. The overlap in binding regions between these chemically distinct antibiotics provides valuable information for rational drug design targeting lspA .

What computational methods assist in understanding lspA-substrate interactions?

Computational approaches have proven valuable for elucidating lspA-substrate interactions:

  • Molecular Docking: Tools like HADDOCK (High Ambiguity Driven protein-protein DOCKing) can predict the binding mode of prolipoproteins to lspA. In published studies, researchers defined active regions on both the enzyme (H1, H2, H3, and the EL) and the substrate (signal peptide) to guide the docking process .

  • Molecular Dynamics Simulations: These can model the dynamic behavior of lspA in membrane environments and its interactions with substrates or inhibitors.

  • Homology Modeling: When experimental structures are unavailable, models based on related proteins can provide insights into B. subtilis lspA structure.

For accurate docking results, careful preparation of input files is essential, including proper labeling of non-standard residues (like lipid-modified cysteines) and defining appropriate distance restraints based on biochemical data .

How does the absence of lspA affect B. subtilis cellular function?

Studies using B. subtilis strains lacking SPase II have revealed several phenotypic consequences:

  • Cells exhibit impaired growth at low and high temperatures, indicating that properly processed lipoproteins are particularly important under these stress conditions .

  • The secretion of certain proteins, such as α-amylase, is strongly impaired in SPase II-deficient cells. This is likely due to the accumulation of lipid-modified precursor and mature-like forms of PrsA (a folding catalyst for secreted proteins) with reduced activity .

  • Surprisingly, developmental processes like competence, sporulation, and germination were not significantly affected despite the requirement for certain lipoproteins in these processes. This suggests potential compensatory mechanisms or partial functionality of unprocessed lipoproteins .

  • Unexpectedly, type I signal peptidases were not involved in alternative amino-terminal processing of pre-PrsA in the absence of SPase II, indicating distinct processing pathways .

These findings suggest that lipoprotein processing by SPase II in B. subtilis is not strictly required for all lipoprotein functions, which is surprising given the conservation of lipoproteins and type II SPases across eubacteria .

What factors affect the efficiency of lspA-mediated processing?

Several factors can influence the efficiency of lipoprotein processing by lspA:

  • Lipobox Sequence Variation: While the consensus lipobox sequence is [L(VI)−3-A(STVI)−2-G(AS)−1-C*+1], variations in these positions can affect recognition and cleavage efficiency .

  • Lipid Modifications: The diacylglyceryl modification of the cysteine residue is essential for recognition by lspA. Alterations in lipid composition or acyl chain structure may affect processing.

  • Surrounding Sequence Context: Residues beyond the strict lipobox may contribute to substrate positioning and processing efficiency.

  • Membrane Environment: The lipid composition of the membrane can affect enzyme activity, as suggested by the positioning of monoolein lipid molecules in crystal structures .

Understanding these factors is essential for optimizing recombinant expression systems and interpreting variations in processing efficiency across different substrates or conditions.

How can species-specific differences in lspA be exploited for antimicrobial development?

Comparative analysis of lspA from different bacterial species reveals both conserved features and potentially exploitable differences:

  • Different sensitivities to inhibitors like globomycin have been observed between lspA from various species (e.g., S. aureus versus P. aeruginosa) .

  • Structural differences in the substrate binding pocket or active site accessibility could be targeted for species-specific inhibitor design.

  • The lack of mammalian homologs and the accessible location of lspA's active site at the outer surface of the inner membrane make it an attractive antimicrobial target .

By understanding the overlap in binding sites between structurally distinct inhibitors like globomycin and myxovirescin, researchers can develop a blueprint for drug design targeting either broad-spectrum or species-specific inhibition of lspA .

How can researchers address challenges in lspA expression and purification?

Common challenges in working with recombinant lspA include:

  • Low Expression Levels: Try codon optimization, different promoters, or alternative host strains. Lower induction temperatures (16-20°C) often increase the yield of properly folded membrane proteins.

  • Inclusion Body Formation: Optimize induction conditions or use solubility-enhancing fusion partners like MBP or SUMO.

  • Loss of Activity During Purification: Screen multiple detergents at various concentrations to find conditions that maintain enzyme structure and function. Consider detergent exchange during purification steps.

  • Aggregation: Incorporate stabilizing agents like glycerol or specific lipids in purification buffers. Size exclusion chromatography is essential for removing aggregates.

  • Variable Activity Measurements: Standardize substrate preparation, enzyme concentration determination, and assay conditions. Use internal controls in each experimental batch.

What controls are essential in lspA activity assays?

Robust experimental design for lspA activity assays should include:

  • Positive Controls: Known active preparations of lspA or commercial enzymes with similar activities.

  • Negative Controls: Heat-inactivated enzyme, catalytic site mutants, or assays in the presence of known inhibitors.

  • Substrate Controls: Verification of substrate purity and proper labeling (for FRET substrates).

  • Assay Validation Controls: Calibration curves using purified reaction products, checks for inner filter effects in fluorescence assays .

  • Buffer Controls: Assessment of buffer components' effects on enzyme activity or assay readout.

When interpreting discrepancies between different assay methods, consider factors like substrate accessibility, enzyme stability in different buffers, and the sensitivity limits of each detection method.

How should researchers interpret contradictory findings across different experimental systems?

When faced with seemingly contradictory results regarding lspA function:

  • Compare experimental conditions in detail, including expression systems, purification methods, and assay conditions.

  • Consider differences between in vitro biochemical studies and in vivo phenotypic analyses. Cellular factors absent in purified systems may affect enzyme function.

  • Evaluate the impact of fusion tags, detergents, and buffer components on enzyme activity and substrate recognition.

  • Assess potential species-specific differences if comparing lspA from different bacterial sources.

  • Examine the temporal aspects of experiments, as short-term effects may differ from long-term adaptations in biological systems.

By systematically analyzing these factors, researchers can often reconcile apparently contradictory findings and develop a more comprehensive understanding of lspA function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.