Recombinant Bacillus subtilis Lipoteichoic acid synthase 2 (ltaS2)

Shipped with Ice Packs
In Stock

Description

Introduction to LTA Synthases in Bacillus subtilis

Lipoteichoic acid (LTA) synthases are critical enzymes in Gram-positive bacteria responsible for synthesizing LTA, an anionic polymer anchored to the cell membrane. In Bacillus subtilis, four LTA synthase orthologues—LtaS (YflE), YfnI (LtaS2), YqgS, and YvgJ—have been identified, each contributing to LTA biosynthesis and cell wall homeostasis . Among these, YfnI (designated LtaS2) plays specialized roles in modulating LTA chain length and interacting with membrane-associated enzymes . Recombinant LtaS2 enables detailed mechanistic studies of LTA biosynthesis and its implications for bacterial physiology and antimicrobial resistance.

Enzymatic Activity and Substrate Specificity

LtaS2 exhibits unique biochemical properties:

PropertyDetailsReferences
Catalytic activityPolymerizes PG into GroP chains; Mn²⁺-dependent
Product profileGenerates longer LTA polymers compared to LtaS (YflE)
Primase activityAbsent (unlike YvgJ, which synthesizes glycolipid primers)
Substrate limitationRequires PG; does not act on phosphatidylcholine or phosphatidylethanolamine

Role in Cell Wall Metabolism and Morphogenesis

LtaS2 contributes to:

  • Cell division: Regulates septal placement and divalent cation (Mg²⁺) homeostasis .

  • Morphogenesis: Mutants lacking LtaS2 exhibit delayed septum formation and increased cell curvature .

  • Sporulation: Partially redundant with LtaS during sporulation initiation .

Interaction with MprF and Antimicrobial Resistance

LtaS2 activity is modulated by the aminoacyl-phosphatidylglycerol synthase MprF, which influences LTA biosynthesis and cell membrane charge :

  • Regulatory mechanism: MprF synthesizes lysyl-phosphatidylglycerol (Lys-PG), altering membrane electrostatics and enhancing LTA synthase activity .

  • Antimicrobial implications:

    • MprF-LtaS2 interactions reduce susceptibility to daptomycin and cationic antimicrobial peptides .

    • Overexpression of MprF retards LTA mobility, suggesting altered polymer length or charge .

Key Studies on Recombinant LtaS2

  1. In vitro assays: Purified LtaS2 synthesizes GroP polymers from PG, confirmed via thin-layer chromatography and Western blot .

  2. Genetic complementation:

    • Expression in Staphylococcus aureus ltaS mutants restores LTA synthesis but not growth, indicating species-specific functional divergence .

    • Quadruple B. subtilis mutants (ΔltaS ΔyfnI ΔyqgS ΔyvgJ) lack LTA and exhibit severe filamentation .

  3. Structural analysis:

    • LTA from LtaS2-overexpressing strains shows higher molecular weight on SDS-PAGE, suggesting extended polymer length .

Biotechnological Applications

Recombinant LtaS2 is leveraged in:

  • Antibiotic development: Targeting LTA biosynthesis pathways to disrupt cell envelope integrity .

  • Protein expression systems: B. subtilis strains engineered with inducible yfnI promoters enable large-scale LTA production .

  • Synthetic biology: Modular systems for studying membrane-protein interactions (e.g., MprF-LtaS2 crosstalk) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ltaS2; yflE; BSU07710; Lipoteichoic acid synthase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
216-649
Protein Length
Full Length of Mature Protein
Species
Bacillus subtilis (strain 168)
Target Names
ltaS2
Target Protein Sequence
DSSDVTEVENYMKANYDVPNNVYFGKAEGKNVIYVSLESLQSFIIDYKIDGKEVTPFLNK LAHDNETFYFDNFFHQTGQGKTSDAEFMMENSLYPLAQGSVFVNKAQNTLQSVPAILKSK NYTSATFHGNTQTFWNRNEMYKAEGIDKFFDSAYYDMNEENTKNYGMKDKPFFKESMPLL ESLPQPFYTKFITLSNHFPFGMDEGDTDFPAGDFGDSVVDNYFQSAHYLDQSIEQFFNDL KKDGLYDKSIIVMYGDHYGISENHNKAMAKVLGKDEITDYDNAQLQRVPLFIHAAGVKGE KVHKYAGDVDVAPTILHLLGVDTKDYLMSGSDILSKEHREVIPFRNGDFISPKYTKISGK YYDTKTGKELDESEVDKSEDSLVKKELEMSDKIINGDLLRFYEPKGFKKVNPSDYDYTKH DEDSSETSKDNEDK
Uniprot No.

Target Background

Function

Function: Catalyzes the polymerization of lipoteichoic acid (LTA) polyglycerol phosphate, utilizing phosphatidylglycerol (PG) as a presumed substrate.

Database Links
Protein Families
LTA synthase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.; [Processed glycerol phosphate lipoteichoic acid synthase 2]: Secreted. Note=The secretion into the extracellular medium is dependent on SecA and Ffh.

Q&A

What is Lipoteichoic Acid Synthase 2 (ltaS2) and its significance in Bacillus subtilis?

Lipoteichoic Acid Synthase 2 (ltaS2) is a critical enzyme in Bacillus subtilis that participates in the synthesis of lipoteichoic acid, an essential component of the cell wall in Gram-positive bacteria. The protein is also known by the gene name yflE (BSU07710) and functions as part of the cellular machinery responsible for maintaining cell wall integrity . The significance of ltaS2 extends beyond structural support—it plays roles in controlling cell division, regulating autolytic activity, and contributing to bacterial resistance against environmental stresses. The enzyme is particularly important for researchers studying bacterial cell wall biosynthesis pathways and potential antimicrobial targets since disruption of lipoteichoic acid synthesis can compromise bacterial viability .

What expression systems are recommended for recombinant Bacillus subtilis ltaS2?

While native expression in Bacillus subtilis offers advantages for certain applications, heterologous expression in E. coli has been successfully employed for recombinant ltaS2 production. According to available data, recombinant full-length Bacillus subtilis ltaS2 protein has been successfully expressed in E. coli with an N-terminal His tag . This approach offers several advantages:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, well-established protocols, easier genetic manipulationPotential folding issues with complex proteins
B. subtilisNative post-translational modifications, efficient secretionRequires specialized vectors, potential proteolysis
Other hostsMay overcome specific expression challengesSystem-specific optimization required

For effective expression, researchers should consider several optimization strategies documented for Bacillus proteins:

  • Codon optimization based on the expression host

  • Fine-tuning of promoter strength

  • Optimization of secretion signals if secreted expression is desired

  • Co-expression with molecular chaperones to enhance proper folding

What are the optimal storage and handling conditions for recombinant ltaS2?

Recombinant Bacillus subtilis ltaS2 requires specific storage and handling conditions to maintain stability and enzymatic activity. According to the available data, the following protocols are recommended:

  • Long-term storage: Store the protein at -20°C/-80°C, preferably with glycerol added to a final concentration of 50% to prevent freeze-thaw damage .

  • Working conditions: Aliquots can be stored at 4°C for up to one week for active experiments .

  • Buffer composition: Tris/PBS-based buffer with 6% Trehalose at pH 8.0 provides good stability for the protein .

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol (5-50% final concentration) and aliquot for long-term storage

  • Critical caution: Repeated freeze-thaw cycles significantly reduce enzymatic activity and should be strictly avoided .

How can researchers verify the activity of recombinant ltaS2?

Verifying enzymatic activity of recombinant ltaS2 is crucial for experimental reliability. Researchers can employ several complementary approaches:

  • Enzymatic activity assay: Monitor the polymerization of glycerol phosphate units derived from phosphatidylglycerol substrates. This can be quantified through:

    • Measurement of released diacylglycerol

    • Detection of incorporated radiolabeled substrates

    • Analysis of polymerization products by chromatographic techniques

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to confirm proper secondary structure

    • Limited proteolysis to evaluate domain folding

    • Thermal shift assays to determine protein stability

  • Functional complementation:

    • Rescue experiments in ltaS-deficient strains

    • Measurement of lipoteichoic acid production in reconstituted systems

When evaluating activity, researchers should consider that the His-tag may influence enzymatic parameters and may need to be removed for certain applications requiring native-like activity.

What are the differences in expression dynamics between native and recombinant ltaS2?

The expression dynamics of native versus recombinant ltaS2 present important considerations for researchers. In native B. subtilis systems, ltaS2 expression is tightly regulated in response to cell wall stress and growth phase transitions. When producing recombinant ltaS2, researchers should account for several key differences:

ParameterNative ltaS2Recombinant ltaS2
Expression timingGrowth-phase dependentInducible, continuous
RegulationResponsive to cell wall stressControlled by vector promoter
Post-translational modificationsComplete native processingMay lack specific modifications
LocalizationMembrane-associatedDepends on expression system
Associated proteinsCo-expressed with functional partnersIsolated expression

For optimal recombinant expression, several strategies have proven effective:

  • Implementation of controlled induction systems to mimic natural expression patterns

  • Co-expression with chaperones to ensure proper folding

  • Optimization of cell growth conditions to enhance protein yield

  • Selection of appropriate host strains with reduced protease activity

How can researchers optimize secretion of recombinant ltaS2 in Bacillus subtilis expression systems?

While the provided data indicates successful expression of ltaS2 in E. coli , Bacillus subtilis itself offers significant advantages as a host for recombinant protein production, particularly for secreted proteins. For researchers seeking to optimize ltaS2 secretion in B. subtilis, several evidence-based strategies can be implemented:

  • Signal peptide optimization: Screening and engineering signal peptides specifically optimized for ltaS2 secretion can dramatically improve yields. The native signal sequence may not be optimal for overexpression scenarios.

  • Secretion pathway enhancement: Overexpression of secretion machinery components (SecA, PrsA) can alleviate bottlenecks in the secretion process.

  • Protease deficient strains: Utilizing strains with reduced extracellular protease activity (ΔaprE, ΔnprE, Δepr, etc.) significantly improves recovery of secreted proteins. Research demonstrates that protease-deficient strains can increase secreted protein yields by 5-10 fold .

  • Secretion stress mitigation: Careful regulation of expression levels to prevent secretion stress responses that can trigger increased protease production.

  • Medium and culture condition optimization: Development of specialized media formulations and fermentation strategies specifically designed for secretory protein production .

The combination of these approaches has been shown to improve secreted protein yields by orders of magnitude compared to unoptimized systems.

What structural features of ltaS2 are critical for enzymatic function and how can they be experimentally determined?

Understanding the structural determinants of ltaS2 function requires sophisticated experimental approaches. Based on analysis of the ltaS2 sequence and related lipoteichoic acid synthases, several structural elements appear critical:

  • Catalytic domain features: The sequence contains the signature motif characteristic of lipoteichoic acid synthases, with key catalytic residues likely including conserved aspartate and histidine residues within the enzyme active site .

  • Experimental approaches to structural characterization:

TechniqueApplication to ltaS2Expected Outcomes
X-ray crystallographyDetermination of three-dimensional structureHigh-resolution structure revealing active site architecture
Site-directed mutagenesisTargeted modification of presumed catalytic residuesIdentification of essential amino acids for catalysis
Hydrogen-deuterium exchange MSMapping of flexible regions and substrate bindingDynamic changes upon substrate binding
Molecular dynamics simulationsIn silico investigation of protein dynamicsConformational changes during catalytic cycle
Cryo-EMVisualization of larger complexes with membranesStructural context within membrane environment
  • Structure-function relationship: Regions of particular interest include:

    • The predicted membrane-association domain (residues near the N-terminus of the mature protein)

    • The substrate binding pocket accommodating phosphatidylglycerol

    • Dimerization interfaces, if applicable to functional assembly

    • Regions responsible for processivity during polymer extension

Researchers exploring these structural features should consider developing construct libraries with systematic mutations or truncations to map functional domains precisely.

How does ltaS2 interact with the cell wall synthesis machinery in Bacillus subtilis?

Lipoteichoic acid synthase 2 functions within a complex network of enzymes involved in cell wall synthesis. Understanding these interactions is crucial for comprehensive characterization of ltaS2 function. Current research suggests the following interaction network:

  • Interaction partners: ltaS2 likely interacts with:

    • Phosphatidylglycerol synthesis enzymes that provide substrates

    • Cell wall teichoic acid synthesis machinery

    • Peptidoglycan biosynthesis components at the division septum

    • Potentially other ltaS paralogs (Bacillus subtilis contains multiple ltaS homologs)

  • Experimental approaches to characterize interactions:

    • Bacterial two-hybrid screening to identify protein partners

    • Co-immunoprecipitation followed by mass spectrometry

    • Fluorescence microscopy with tagged proteins to examine co-localization

    • Crosslinking experiments to capture transient interactions

    • Protein-fragment complementation assays to confirm direct interactions

  • Functional significance:
    Understanding these interactions can reveal:

    • How ltaS2 activity is coordinated with cell division

    • Whether ltaS2 functions within a larger enzymatic complex

    • How substrate channeling may occur between synthesis pathways

    • The regulatory mechanisms controlling ltaS2 activity in response to cell wall stress

Disruption of specific protein-protein interactions through targeted mutations can provide valuable insights into the functional significance of these interactions.

What techniques are most effective for studying ltaS2 inhibition as a potential antimicrobial strategy?

Given the essential role of lipoteichoic acid in Gram-positive bacterial cell walls, ltaS2 inhibition represents a promising antimicrobial strategy. Researchers exploring this avenue can employ several complementary approaches:

  • High-throughput screening approaches:

    • Development of enzymatic assays suitable for screening compound libraries

    • Whole-cell screening with ltaS2 reporter strains

    • Fragment-based drug discovery focusing on the active site

  • Structure-based inhibitor design:

    • Virtual screening using the ltaS2 structure (or homology model)

    • Rational design of transition state analogs

    • Development of covalent inhibitors targeting catalytic residues

  • Evaluation methods for inhibitor efficacy:

Assay TypeMeasurementAdvantages
In vitro enzymaticDirect measurement of ltaS2 activity inhibitionDirect assessment of target engagement
Bacterial growthMIC determination in B. subtilis and related pathogensAssessment of whole-cell activity
Lipoteichoic acid quantificationMeasurement of LTA levels in treated cellsConfirmation of on-target effect
Cell wall integrityMicroscopy, osmotic stability testsPhenotypic confirmation
Resistance developmentSerial passage experimentsAssessment of resistance barrier
  • Considerations for inhibitor development:

    • The enzyme's membrane association may require specialized inhibitor properties

    • Potential for developing dual-targeted inhibitors affecting multiple ltaS paralogs

    • Need for penetration of the Gram-positive cell envelope

    • Selectivity versus human enzymes to minimize toxicity

When designing inhibition studies, researchers should incorporate appropriate controls including known cell wall active antibiotics (e.g., vancomycin) for comparison.

How can researchers utilize recombinant ltaS2 for developing vaccines or immunotherapeutics?

While primarily known for its enzymatic function, recombinant ltaS2 may also serve as a foundation for vaccine development and immunotherapeutic approaches against Gram-positive pathogens. Several research directions are particularly promising:

  • Antigen potential assessment:

    • Epitope mapping to identify immunogenic regions

    • Evaluation of conservation across pathogenic species

    • Analysis of accessibility in intact bacterial cells

    • Assessment of immune response to recombinant ltaS2 in animal models

  • Vaccine development approaches:

    • Creation of attenuated B. subtilis strains with modified ltaS2

    • Development of subunit vaccines using recombinant ltaS2 or immunogenic fragments

    • Design of glycoconjugate vaccines linking ltaS2 with bacterial polysaccharides

  • Immunotherapeutic applications:

    • Production of monoclonal antibodies targeting specific ltaS2 epitopes

    • Development of antibody-antibiotic conjugates for targeted delivery

    • Exploration of ltaS2-based immunomodulatory effects

  • Technical considerations:

    • Ensuring appropriate folding of antigenic determinants in recombinant constructs

    • Addressing potential adjuvant requirements for effective immune response

    • Optimizing formulation stability for vaccine candidates

    • Establishing correlates of protection in preclinical models

This research direction requires careful consideration of species-specific variations in ltaS2 structure and immunogenicity across different Gram-positive bacteria.

What are common challenges in purifying active recombinant ltaS2 and how can they be addressed?

Purification of functional recombinant ltaS2 presents several challenges that researchers should anticipate. Based on the characteristics of the protein and related enzymes, the following issues and solutions can be considered:

  • Solubility limitations:

    • Challenge: As a membrane-associated enzyme, ltaS2 may have hydrophobic regions leading to aggregation.

    • Solutions:

      • Expression of catalytic domain only (mature protein residues 216-649)

      • Inclusion of mild detergents during extraction (0.1-0.5% Triton X-100 or n-dodecyl-β-D-maltoside)

      • Optimization of salt concentration in buffers

      • Use of solubility-enhancing fusion tags beyond His-tag (SUMO, MBP)

  • Proteolytic degradation:

    • Challenge: Sensitivity to proteases during expression and purification.

    • Solutions:

      • Addition of protease inhibitor cocktails during all purification steps

      • Use of protease-deficient expression strains

      • Minimizing purification time and maintaining cold temperatures

      • Optimization of buffer pH to reduce protease activity

  • Loss of activity during purification:

    • Challenge: Enzymatic activity may decrease during purification procedures.

    • Solutions:

      • Inclusion of stabilizing agents (glycerol, specific ions)

      • Avoidance of freeze-thaw cycles

      • Addition of reducing agents to maintain thiol groups

      • Monitoring activity throughout purification process

  • Purification protocol optimization:

Purification StepCritical ParametersTroubleshooting
Immobilized metal affinityImidazole concentration, flow rateOptimize imidazole gradient, test different metal ions
Size exclusionBuffer composition, oligomeric stateAnalyze different fractions for activity, not just purity
Ion exchangeSalt gradient, pHTest various pH values to identify optimal binding
Affinity tag removalProtease conditions, efficiencyOptimize cleavage conditions, test different sites

When designing purification protocols, researchers should always validate the functional state of the purified protein through activity assays rather than relying solely on purity assessments.

How can researchers design experiments to investigate ltaS2 substrate specificity?

Understanding the substrate specificity of ltaS2 is essential for characterizing its function and developing potential inhibitors. Researchers can employ several experimental approaches:

  • Substrate library screening:

    • Preparation of synthetic phosphatidylglycerol analogs with varied acyl chain lengths

    • Testing natural phospholipid mixtures from different sources

    • Evaluation of non-natural substrate alternatives

  • Kinetic characterization:

    • Determination of Michaelis-Menten parameters for different substrates

    • Competition assays between potential substrates

    • Evaluation of product inhibition patterns

  • Structural approaches to substrate binding:

    • Co-crystallization with substrate analogs or product molecules

    • Hydrogen-deuterium exchange mass spectrometry to map binding interfaces

    • Molecular docking simulations to predict binding modes

  • Experimental design considerations:

ParameterMethodologyExpected Outcome
Chain length preferenceVaried PG acyl chainsOptimal chain length for catalysis
Headgroup specificityModified headgroupsTolerance for headgroup modifications
StereoselectivityEnantiomeric substratesPreference for specific stereochemistry
Counter-ion requirementsVaried ionic conditionsIdentification of essential cofactors
  • Data analysis approaches:

    • Determination of specificity constants (kcat/Km) for comparative analysis

    • Structure-activity relationship development

    • Computational models to predict substrate compatibility

These experiments should incorporate appropriate controls, including heat-inactivated enzyme and known non-substrate lipids, to ensure accurate interpretation of specificity patterns.

How should researchers analyze and interpret kinetic data from ltaS2 enzymatic assays?

Robust kinetic analysis of ltaS2 activity requires careful experimental design and appropriate data interpretation. Researchers should consider the following approach:

  • Experimental design for kinetic analysis:

    • Ensure linearity of enzyme activity over the measurement time

    • Confirm that substrate consumption is <10% for initial rate measurements

    • Include sufficient data points across substrate concentration range (minimum 7-8 concentrations)

    • Perform measurements in at least triplicate for statistical validity

  • Kinetic models for data fitting:

Kinetic PatternMathematical ModelGraphical Analysis
Michaelis-Mentenv = Vmax[S]/(Km+[S])Hyperbolic curve
Substrate inhibitionv = Vmax[S]/[Km+S]Decreasing velocity at high [S]
Allosteric behaviorv = Vmax[S]^n/(K'+(S)^n)Sigmoidal curve
Bi-substrate reactionsVarious (Ping-Pong, Ordered, Random)Product vs. substrate matrices
  • Parameter interpretation:

    • Km: Affinity of enzyme for substrate (lower value = higher affinity)

    • kcat: Turnover number (catalytic events per unit time)

    • kcat/Km: Catalytic efficiency, particularly useful for comparing substrates

    • Ki: Inhibition constant for substrate or product inhibition

  • Common challenges in ltaS2 kinetic analysis:

    • Detergent effects on apparent kinetic parameters

    • Potential aggregation states affecting measured activity

    • Product inhibition complicating initial rate measurements

    • Limited solubility of lipid substrates requiring careful preparation

  • Statistical validation:

    • Calculate confidence intervals for all kinetic parameters

    • Perform model discrimination tests when multiple models fit data

    • Use residual analysis to detect systematic deviations from models

Accurate kinetic characterization provides essential insights into ltaS2 function and creates a foundation for inhibitor development and structure-function analysis.

What bioinformatic approaches are most valuable for investigating ltaS2 evolution and conservation?

Bioinformatic analysis provides crucial context for understanding ltaS2 function and evolution across bacterial species. Researchers should consider these approaches:

  • Sequence analysis and homology:

    • Multiple sequence alignment of ltaS homologs across Gram-positive bacteria

    • Phylogenetic tree construction to understand evolutionary relationships

    • Identification of conserved motifs using MEME, PROSITE, or similar tools

    • Calculation of conservation scores across the protein sequence

  • Structural bioinformatics:

    • Structure prediction using AlphaFold2 or RoseTTAFold

    • Mapping of conservation onto predicted structural models

    • Identification of potential catalytic residues through structure-guided analysis

    • Investigation of structural similarities with other enzymes

  • Genomic context analysis:

Analysis TypeTool/ApproachInsights Gained
Gene neighborhoodGenomic context viewersCo-evolved gene systems
Regulon analysisTranscriptome data integrationCo-regulated genes
Horizontal gene transferAnomalous GC content, codon usageEvolutionary origin
Paralog comparisonSequence and structural comparisonFunctional specialization
  • Protein-protein interaction prediction:

    • Co-evolution analysis to identify potential interaction partners

    • Docking simulations with predicted partners

    • Integration of experimental interaction data from related species

  • Functional domain analysis:

    • Hidden Markov Model (HMM) searches to identify functional domains

    • Analysis of domain architecture across homologs

    • Investigation of domain fusion events in the evolutionary history

These bioinformatic approaches should be integrated with experimental data to validate predictions and generate testable hypotheses about ltaS2 function and evolution.

What are the most promising future research directions for Bacillus subtilis ltaS2?

Based on current understanding of ltaS2 and the broader field of bacterial cell wall biosynthesis, several research directions show particular promise:

  • Structural biology advances:

    • High-resolution crystal structures of ltaS2 in different catalytic states

    • Cryo-EM studies of ltaS2 in membrane environments

    • Investigation of potential oligomeric states and their functional significance

  • Systems biology integration:

    • Comprehensive mapping of the ltaS2 interactome

    • Analysis of ltaS2 regulation within the cell wall stress response network

    • Investigation of coordination between peptidoglycan and lipoteichoic acid synthesis

  • Translational research opportunities:

    • Development of ltaS2 inhibitors as novel antimicrobials

    • Exploitation of lipoteichoic acid pathway for bioengineering applications

    • Creation of modified B. subtilis strains with altered cell surface properties

  • Methodological innovations needed:

    • Improved assays for real-time monitoring of ltaS2 activity

    • Development of cellular reporters for lipoteichoic acid synthesis

    • Advanced microscopy techniques to visualize ltaS2 localization and dynamics

  • Interdisciplinary collaborations:

    • Integration of structural biology with synthetic biology approaches

    • Combination of biophysical techniques with genetic engineering

    • Computational modeling informed by experimental biochemistry

These research directions build upon the current understanding of ltaS2 function while addressing significant knowledge gaps that limit full exploitation of this enzyme's potential in both basic science and applications.

How can researchers contribute to standardizing protocols for recombinant ltaS2 research?

Standardization of research protocols is essential for advancing the field and ensuring reproducibility of ltaS2 studies. Researchers can contribute through:

  • Detailed methodology reporting:

    • Complete description of expression constructs including sequence variations from wild-type

    • Precise purification protocols with buffer compositions

    • Clear specification of activity assay conditions and detection methods

    • Thorough documentation of protein handling and storage procedures

  • Reference standard development:

    • Establishment of standard ltaS2 preparations with defined specific activity

    • Development of benchmark substrates for activity comparisons

    • Creation of validated antibodies or detection reagents

  • Data sharing initiatives:

Resource TypeImplementationCommunity Benefit
Protocol repositoriesDetailed protocols in repositories like protocols.ioMethodological consistency
Material exchangePlasmid deposits in AddGene or similar repositoriesReduced variability in starting materials
Raw data availabilityDeposition of raw kinetic and structural dataEnhanced reproducibility assessment
Negative results reportingPublication of failed approachesPrevention of repeated unsuccessful strategies
  • Validation criteria establishment:

    • Definition of activity benchmarks for functional recombinant ltaS2

    • Development of quality control metrics for protein preparations

    • Establishment of minimum reporting standards for ltaS2 characterization

  • Collaborative network development:

    • Organization of focused research groups or consortia

    • Regular workshops for standardization discussions

    • Cross-laboratory validation studies

Through these standardization efforts, the research community can accelerate progress in understanding ltaS2 biology and developing applications based on this important enzyme.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.