Recombinant Bacillus subtilis Magnesium transporter mgtE (mgtE)

Shipped with Ice Packs
In Stock

Description

Introduction and Overview

MgtE is a high-affinity Mg²⁺ transporter in B. subtilis, regulated by magnesium-responsive genetic elements . It belongs to the MgtE family, which lacks sequence similarity to other known transporter families like CorA . Recombinant MgtE refers to the protein expressed heterologously in non-native systems (e.g., vertebrate cells or engineered B. subtilis strains) to study its transport mechanics, regulatory roles, or biotechnological applications .

Functional Roles in Magnesium Homeostasis

MgtE serves as the primary Mg²⁺ importer in B. subtilis:

  • Essentiality: Strains lacking mgtE exhibit severe Mg²⁺ dependency, requiring ≥2.5 mM extracellular Mg²⁺ for growth .

  • Redundancy: Partially overlaps with CitM, a citrate-coupled Mg²⁺ transporter, under specific conditions .

  • Heterologous function: Recombinant MgtE rescues Mg²⁺ deficiency in TRPM7-deficient vertebrate B-cells, demonstrating cross-species functionality .

Expression Systems

  • Bacterial hosts: B. subtilis is a preferred host due to its GRAS status and well-characterized secretion pathways .

  • Vertebrate cells: MgtE expressed in TRPM7-deficient DT40 B-cells restores Mg²⁺ uptake and proliferation .

Key Findings from Heterologous Expression

SystemOutcomeCitation
TRPM7-deficient DT40Rescues cell growth and Mg²⁺ uptake
Salmonella entericaComplements Mg²⁺ transport defects

Regulatory Mechanisms and Proteolytic Processing

  • Genetic regulation: Controlled by a Mg²⁺-responsive riboswitch in its 5’ untranslated region .

  • Post-translational regulation:

    • Cleaved by the rhomboid protease YqgP under Mn²⁺ stress to prevent Mn²⁺ toxicity .

    • Degradation is Mg²⁺-dependent; high Mg²⁺ (>1 mM) suppresses cleavage .

Table 2: Regulatory Interactions of MgtE

ConditionRegulatory MechanismEffect on MgtE
Low Mg²⁺ (≤0.01 mM)Riboswitch activation → mgtE upregulationIncreased expression
High Mn²⁺ (≥50 μM)YqgP-mediated cleavageDegradation reduces Mn²⁺ uptake

Genetic Knockout Studies

  • Single-gene deletions: Only mgtE disruption causes Mg²⁺ auxotrophy .

  • Multi-gene deletions: Strains lacking mgtE, yloB, yfjQ, and yqxL require suppressor mutations in housekeeping genes (e.g., ATP synthase components) to survive .

Biophysical Insights

  • Electrophysiology: No detectable currents in MgtE-expressing DT40 cells, suggesting electroneutral transport .

  • Thermal stability: N-terminal domain deletion reduces protein aggregation, implicating this region in structural stability .

Challenges and Future Directions

  • Expression bottlenecks: Despite B. subtilis’s utility, optimizing MgtE secretion remains challenging due to poorly understood export pathways .

  • Structural studies: Full-length MgtE structure and gating mechanics require further elucidation.

  • Biotechnological applications: Engineered MgtE variants could enhance Mg²⁺ uptake in industrial fermentation strains .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them when placing your order. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. Should you require dry ice shipment, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliqouting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the product for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
mgtE; ykoK; BSU13300; Magnesium transporter MgtE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-451
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
mgtE
Target Protein Sequence
MVQNMTYDELILRIIILLRDGKIRDFRSVIDELQPYDMAFIFKEMPEKHRARYLSYLTVD DITDMIGELEREFQLVVLNKVGKTKATLAMNKMDNDDLAQLLEEMDEELKEQLLSSMEAS ESKAVQLLMNYPADSAGRMMTNRYVWIPQHYTVKDAVVKLKSFAEIAESINYLYVINESK QLVGVLSYRDLILGEPEEKVQDLMFTRVISADALQDQEEVARLIERYDFLAIPVVEENNV LVGIVTVDDIIDVVIREADEDYEKFAASGKDITFDTKAYVAAYRRLPWLILLLFIGLISG SIISYFEDALKQVVALAFFMPMVSGMTGNTGTQSLAVVIRGLSKEEMNKKTIVRLIFREF RTSIFIGAVCSVLIAIVSIIWQGNALLGFVVASSLFLTLIIGTMSGTIIPIILHKLKVDP AIASGPLITTLNDILSLLIYFGIATAFIHSL
Uniprot No.

Target Background

Function
Functions as a magnesium transporter.
Gene References Into Functions
  1. Research indicates that the mgtE protein serves as the primary magnesium import pathway in Bacillus subtilis. PMID: 24415722
Database Links
Protein Families
SLC41A transporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of MgtE in Bacillus subtilis?

MgtE is a distinct membrane protein transporter with no sequence similarity to other magnesium transporter families like CorA. The protein contains cytoplasmic domains that function as magnesium-sensing mechanisms controlling metal import. These domains act as gating mechanisms that respond to magnesium concentration changes, regulating the opening and closing of the transport channel . The protein's structure enables it to selectively transport magnesium ions across the bacterial membrane, making it essential for maintaining proper intracellular magnesium levels.

What evidence confirms MgtE as the primary magnesium importer in B. subtilis?

Multiple lines of evidence establish MgtE as the primary magnesium transporter in B. subtilis:

  • Mutational studies show that disruption of mgtE results in strong dependency on supplemental extracellular magnesium

  • Unlike other potential magnesium transporters that maintain relatively low expression, MgtE is significantly upregulated under low-magnesium conditions

  • This upregulation occurs through a magnesium-responsive regulatory RNA element

  • Genetic studies have demonstrated that while B. subtilis encodes multiple potential magnesium transporters, only mgtE mutation produces severe magnesium dependency

How does MgtE respond to varying environmental conditions?

MgtE activity is directly affected by environmental metal concentrations:

  • Low magnesium conditions trigger upregulation through a magnesium-responsive RNA element

  • In soil environments where B. subtilis naturally lives, acidic pH decreases magnesium availability while increasing manganese bioavailability

  • Under low magnesium and high manganese/zinc conditions, MgtE undergoes proteolytic regulation by YqgP and FtsH

  • These regulatory mechanisms help protect B. subtilis from metal toxicity while ensuring adequate magnesium uptake

What are optimal conditions for expressing recombinant MgtE in B. subtilis?

For successful expression of recombinant MgtE:

ParameterRecommended ConditionNotes
Expression vectorpHyper-SPANK with IPTG-inducible Pspac promoterIntegration at amyE locus
IPTG concentration5 μMHigher concentrations prove toxic
Media supplement10 mM MgCl₂Enhances transformation efficiency
Growth conditions37°C with shakingStandard conditions for B. subtilis
Outgrowth medium2× YT with 50 mM MgCl₂Supports growth of MgtE-expressing strains

The toxicity observed at higher IPTG concentrations likely reflects physiological disruption when MgtE is overexpressed, suggesting careful titration is necessary for experimental work .

What methods can be used to quantify MgtE activity and processing in vivo?

Several complementary approaches can be employed:

  • Growth assays in minimal media with varied magnesium concentrations (functional measurement)

  • Quantitative fluorescence immunoblotting using anti-MgtE antibodies to detect:

    • Full-length MgtE protein

    • Cleaved forms resulting from proteolytic processing

  • Substrate conversion measurement by calculating the ratio:
    signal(P)/[signal(S) + signal(P)]
    where P = cleavage product and S = full-length substrate

  • SILAC (Stable Isotope Labeling with Amino Acids in Cell Culture) combined with LC-MS/MS for precise quantification of MgtE levels and processing under different conditions

How should researchers prepare B. subtilis strains for MgtE functional studies?

The following protocol is recommended based on published methodology:

  • Initial culture preparation:

    • Streak strains on TBAB medium supplemented with 50 mM MgCl₂

    • Add appropriate antibiotics if selection markers are present

    • Incubate overnight at 37°C

  • Main culture growth:

    • Inoculate 25 ml of 2× YT supplemented with 50 mM MgCl₂

    • Grow with shaking at 37°C until OD₆₀₀ reaches ~0.5

    • Pellet cells and wash twice with 10 ml 2× YT

    • Resuspend in 10 ml 2× YT and dilute to OD₆₀₀ ~0.05

    • Add IPTG (0.5 mM for most constructs, 5 μM for MgtE)

  • For minimal medium experiments:

    • Prepare overnight cultures in MM with 10 mM MgCl₂

    • Transfer to shaking incubator when ready for experiment

    • When culture reaches OD₆₀₀ ~0.5, pellet, wash, and resuspend in minimal medium without added MgCl₂

    • Dilute to OD₆₀₀ ~0.1 and add 2.5 mM MgCl₂ plus appropriate IPTG concentration

What is the mechanism behind YqgP-mediated proteolytic regulation of MgtE?

YqgP, a rhomboid intramembrane protease in B. subtilis, regulates MgtE through a sophisticated mechanism:

  • YqgP interacts with the membrane-bound ATP-dependent metalloprotease FtsH

  • The N-terminal cytosolic domain of YqgP binds Mn²⁺ and Zn²⁺ ions

  • This binding facilitates YqgP-mediated cleavage of MgtE

  • MgtE cleavage is enhanced under conditions of low magnesium and high manganese/zinc

  • Beyond its intrinsic protease activity, YqgP functions as a substrate adaptor for FtsH

  • This adaptor function is necessary for complete degradation of MgtE

This regulatory system protects B. subtilis from potential toxicity of non-magnesium divalent cations. Researchers studying this mechanism should consider both the direct proteolytic activity of YqgP and its adaptor function for FtsH .

How can researchers investigate metal selectivity of MgtE under varying conditions?

To study MgtE's ability to transport different metals depending on environmental conditions:

  • Metal competition assays:

    • Use isotopically labeled metals (e.g., ⁶⁵Zn, ⁵⁴Mn)

    • Measure transport in the presence of varying Mg²⁺ concentrations

    • Complement with ICP-MS analysis of intracellular metal content

  • Site-directed mutagenesis approach:

    • Target predicted metal-binding residues in MgtE

    • Express mutant variants using the 5 μM IPTG induction system

    • Assess growth and metal accumulation in defined media

  • In vivo functional studies:

    • Compare wild-type and gain-of-function MgtE mutants

    • Test growth in Mn-limiting conditions with varying Mg²⁺ levels

    • This approach parallels observations in other systems where MgtE mutations affect manganese transport

Evidence suggests MgtE may transport manganese when magnesium does not compete with it, particularly relevant in Bradyrhizobium japonicum where gain-of-function MgtE mutants can support growth in manganese-limiting conditions .

What experimental approaches can reveal the relationship between MgtE and ATP synthase?

The connection between MgtE function and ATP synthase activity represents an intriguing area for investigation:

  • Genetic interaction studies:

    • B. subtilis strains defective in magnesium transport can be rescued by inactivation of ATP synthase-encoding genes

    • Construct double mutants affecting both systems

    • Measure growth rates under varying magnesium concentrations

  • Biochemical assessments:

    • Measure ATP levels and ATP synthase activity in wild-type versus mgtE mutants

    • Use fluorescent probes to distinguish free versus bound magnesium pools

    • Quantify ribosome assembly, which requires significant magnesium

  • Experimental design considerations:

    • Control magnesium concentrations precisely in all growth media

    • Consider the dynamic relationship where low magnesium leads to ATP synthase inhibition

    • This inhibition may liberate magnesium from ATP-bound pools for essential processes like ribosome assembly

This research direction parallels findings from Salmonella enterica, where magnesium limitation affects ATP synthase function as part of a coordinated cellular response .

What protocols are recommended for analyzing MgtE cleavage products?

For detailed analysis of MgtE cleavage:

  • Preparation of reference fragments:

    • PCR using mgtE-specific primers containing SP6 RNA polymerase promoter and ribosome-binding site

    • In vitro transcription and translation using Wheat Germ Extract

    • Purification of translation products containing MgtE reference fragments

  • Western blot analysis:

    • Separate proteins using SDS-PAGE (4-20% gradient Tris-glycine recommended)

    • Visualize using polyclonal anti-MgtE(2-275) antibody

    • Quantify using fluorescence-based detection systems

  • Mass spectrometry approach:

    • Enrich transmembrane proteins using sequential washing with 0.1 M Na₂CO₃ and 1 M NaCl

    • Perform in-gel digestion using standard protocols

    • Analyze tryptic peptides via LC-MS/MS

How can researchers investigate the differential expression of MgtE under varying conditions?

To study MgtE expression regulation:

  • RNA-level analysis:

    • RT-qPCR targeting mgtE transcripts

    • RNA structure probing to examine the magnesium-responsive RNA element

    • RNA-seq to identify co-regulated genes

  • Protein-level quantification:

    • SILAC labeling with "heavy" and "light" amino acids

    • Experiment design should include label swapping to control for labeling artifacts

    • Samples should be resolved in separate gel lanes for optimal results

  • Data analysis considerations:

    • Use at least two biological replicates with swapped labeling

    • Perform robust statistical analysis

    • Consider environmental variables beyond just magnesium (pH, presence of other metals)

What contradictions exist in the literature regarding MgtE function, and how might researchers address them?

Several research questions remain unresolved:

  • Divalent cation selectivity:

    • Evidence suggests MgtE may transport manganese when magnesium is limited

    • This contradicts the traditional view of MgtE as a magnesium-specific transporter

    • Research design should include direct measurement of transport rates for multiple metals

  • YqgP regulation mechanism:

    • The dual function of YqgP (direct protease and adaptor for FtsH) raises questions about the relative importance of each function

    • Experiments should separate these functions through targeted mutations

  • ATP synthase relationship:

    • The mechanism by which ATP synthase inactivation rescues magnesium transport defects remains unclear

    • Metabolomic approaches could reveal how cellular magnesium pools are redistributed

How might structural studies advance understanding of MgtE regulation?

While current research provides functional insights, structural studies would significantly advance the field:

  • Potential techniques:

    • X-ray crystallography of MgtE in different conformational states

    • Cryo-electron microscopy to visualize the protein in its native membrane environment

    • Molecular dynamics simulations to model magnesium-dependent conformational changes

  • Key research questions:

    • How do the cytoplasmic domains sense magnesium concentrations?

    • What conformational changes occur during channel gating?

    • How does YqgP recognize and cleave MgtE?

  • Experimental approaches:

    • Express and purify full-length MgtE with appropriate detergents or nanodiscs

    • Generate antibodies against specific domains for co-crystallization

    • Use site-directed spin labeling for EPR studies of conformational dynamics

What systems biology approaches would provide insight into MgtE's role in the broader context of metal homeostasis?

MgtE function should be investigated in the context of global metal homeostasis:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Compare wild-type and mgtE mutant responses to various metal stresses

    • Identify compensatory mechanisms activated during magnesium limitation

  • Network analysis:

    • Map interactions between magnesium, manganese, and zinc homeostasis systems

    • Identify regulatory hubs and feedback mechanisms

    • Model how soil conditions (pH, metal availability) affect these networks

  • Soil microbiome studies:

    • Examine how MgtE function affects B. subtilis fitness in natural environments

    • Compare metal transport systems across soil bacteria species

    • Investigate ecological implications of metal competition strategies

The emerging understanding of MgtE within these broader contexts will provide valuable insights for both basic microbiology and biotechnological applications of Bacillus subtilis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.